SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000022954 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000022954
Domain Number 1 Region: 217-549
Classification Level Classification E-value
Superfamily DNase I-like 2.88e-72
Family Inositol polyphosphate 5-phosphatase (IPP5) 0.00000183
Further Details:      
 
Domain Number 2 Region: 667-683,722-882
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 7.46e-34
Family BCR-homology GTPase activation domain (BH-domain) 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000022954   Gene: ENSGACG00000017367   Transcript: ENSGACT00000022997
Sequence length 892
Comment pep:known_by_projection group:BROADS1:groupIV:6594255:6605922:-1 gene:ENSGACG00000017367 transcript:ENSGACT00000022997 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TVKVQELRAGQKEPRLLSLIERRGEFVVKKIIEKAHSNESMAQLSIPINGHFEIVREAEE
ALLINLSVASGVRIRISGERAPQLLLELQDDDRTQTFLAQVMSAQQQATNALPPNLNNSR
STNQTKTDLVQSLASDFGFEDNFNHALKVEEKKNHQNRIVAVREPPPVPPLPPRKASYAP
SNPLPAAPIPKDRAVSLQTRDHSKPDQAGQREYLVKHLLGKKEKEYVDIKTFKFFTGTWN
VNGQAPDSSLVPWLCCDTEPPDIYALGFQELDLSTEAFFYMDSSKEQLWVEAMERSLHPK
AKYKKVRIIRLVGMMLVVFVKKIYKNLIKEVAAEHVGTGIMGKMGNKGGVAVRFVFHNTS
FCIVNSHLAAHVEDFERRNQDYKDICARMTFHLLDQPPLNIVKHDVVIWLGDLNYRLCLY
DAADVKFHISQNELKRLQEVDQLNIQRQTKKAFTDFMEGEINFMPTYKYDPKTDRWDSSG
KCRVPAWCDRILWRGNNVKQLKYRSHMELKTSDHKPVSALFSVGVKVVNDPRYKKVFEEI
VRAMDRMENDFLPSVTLDKREFAFANVKFRQLQRERFVITNDGQVPCHFAFIPKLNDSQY
CKPWLRAEPSDGFLEPNETLEIYLDVYVSKDSVTLLNSGEDAIEDILVLHLDRGKDYFIT
ISGNYLPSCFGTSLETLCRMKKPIREIPITRLIDLEEDSYMEKEKSKMSFLMVEGSGTED
KPLKIPKEVWILVNHLFTKSCDQEDLFQTPGLQDELQGIIDCLDTSIPDSISGCNHSVAE
ALLIFLEALPEPVLCYELYHRCLECAHDSRLCKQLISQLPRAHRNVFRYLMAFLKELLKH
SHNNNLTASLIATLFASLLIRPPPNLMGKHTPHERQKAIDFILGFLMAGDEE
Download sequence
Identical sequences G3PZB4
ENSGACP00000022954 ENSGACP00000022954 69293.ENSGACP00000022954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]