SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000023261 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000023261
Domain Number 1 Region: 167-306
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.34e-26
Family UBX domain 0.01
Further Details:      
 
Domain Number 2 Region: 6-55
Classification Level Classification E-value
Superfamily UBA-like 1.56e-16
Family UBA domain 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000023261   Gene: ENSGACG00000017599   Transcript: ENSGACT00000023307
Sequence length 307
Comment pep:known_by_projection group:BROADS1:groupIV:8225925:8229286:-1 gene:ENSGACG00000017599 transcript:ENSGACT00000023307 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAELTTLESLLEMGFERNRAEKAVANTGNQGIEQAMDWLMEHENDPDIDEPFVPPVGNVL
GGEADSQSTTEQPSLADTAEGTADGVGNYDNDDTSARMPMSEEEKLEQVRRLEELMRVKQ
AERRERERAEELEREKQRRRQGQELQQIRQKLQDDDMKKLADQRMKEKMEDKMARQRVKD
KIARDREERAQKFGGIAPPSTASSSQPAQPSPSSPTSHGPPPTKKEYDESRIQVRLLDGS
TLTAVFKAQEPLAAVRVYVQVNGNTPEGQDFTLLSPYPRHVYTELDMEKPLKELGLVPSA
VLVVAKK
Download sequence
Identical sequences G3Q071
ENSGACP00000023261 69293.ENSGACP00000023261 ENSGACP00000023261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]