SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Gasterosteus aculeatus 76_1 > ENSGACP00000023420

Domain assignment for ENSGACP00000023420 from Gasterosteus aculeatus 76_1

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSGACP00000023420
Domain Number 1	Region: 54-92
Classification Level	Classification	E-value
Superfamily	LDL receptor-like module	0.00000000109
Family	LDL receptor-like module	0.0015
Further Details:

Domain Number 2	Region: 13-62
Classification Level	Classification	E-value
Superfamily	EGF/Laminin	0.000000608
Family	EGF-type module	0.018
Further Details:

Domain Number 3	Region: 128-164
Classification Level	Classification	E-value
Superfamily	EGF/Laminin	0.0000955
Family	EGF-type module	0.074
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Biological Process	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSGACP00000023420 Gene: ENSGACG00000017722 Transcript: ENSGACT00000023466
Sequence length	245
Comment	pep:novel group:BROADS1:groupXIV:9062059:9065180:1 gene:ENSGACG00000017722 transcript:ENSGACT00000023466 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	VEVQAHSNASQSGTNGCSKNNGGCVHLCLPYPGDRACKCGRGFYGATCAPLPGCPAGEQS CFDGTKCIVSSKFCDGEVDCPDGSDEQDCPNTNSASFWTKSSDGRPLPSSPPHPDNVQKN AIHTVKDPSSCGLQRCNGLGHCITEGQVTRCQCVAGYQGESCQEAETGRGHVAVILGVFF LVTALTLAAFVFAKRRDWPSIRSRSTEKETLMENMHLPCEHYDSDCEELDSPVDVKNPPL ALKSM
Download sequence
Identical sequences	G3Q0M5 ENSGACP00000023420 69293.ENSGACP00000023420 ENSGACP00000023420

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]