SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000023482 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000023482
Domain Number 1 Region: 649-792
Classification Level Classification E-value
Superfamily C-type lectin-like 5.95e-40
Family C-type lectin domain 0.00000419
Further Details:      
 
Domain Number 2 Region: 164-278
Classification Level Classification E-value
Superfamily C-type lectin-like 3.44e-38
Family Link domain 0.0018
Further Details:      
 
Domain Number 3 Region: 271-370
Classification Level Classification E-value
Superfamily C-type lectin-like 1.01e-29
Family Link domain 0.0039
Further Details:      
 
Domain Number 4 Region: 45-167
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000958
Family V set domains (antibody variable domain-like) 0.029
Further Details:      
 
Domain Number 5 Region: 793-851
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000334
Family Complement control module/SCR domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000023482   Gene: ENSGACG00000017768   Transcript: ENSGACT00000023528
Sequence length 885
Comment pep:known_by_projection scaffold:BROADS1:scaffold_137:219225:231929:1 gene:ENSGACG00000017768 transcript:ENSGACT00000023528 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKPDVSLAVLLSAICLLCLPSSSSHHQESELILSSDESKLLQVTIPAPPPVGAVLGGSLT
LPCLVSPAHPPPLHSAAGGRHAALSLPRVKWSVLINGNEAEILVARGDRVRVSEAYRDRA
TLLNYVSSPADLTLQLERLRRNDTGFYRCEVQQGLEDAHDVAQVKVKGVVFHYRDASSRY
GFTFERAREACEGIGAEIASPEQLLAAYHSGYERCDAGWLADRSVRYPIQRPREQCFGDM
EEFPGVRNYGLLDPDEMYDVYCYVENIHGEVFHGSAPQRFTFWEARAYCLSHGAELVTTA
QLYAAWSDGLNLCSPGWLADGSVRYPIVTPRERCGGGEPGVRTVYRYGNQTGFPELHTRH
DVYCFRGKDIDPAAEEEEEGEEELLVSEATLKEGDEVQRAQATNPVKRGPADSSPPARMG
ASTPLDGEPPEGRTSETESWDTPAFSVTPVTGELRADSPGSPQGGELPVSREDPTLGVHL
EAALEAELVHSTEEATTSSPPTEEESGDGSVNPPLDEETQGSTTASLRPPLQKSPQRPPA
SEVNAETPAPRSSQRPRSHSPAAGPPEDVRGGLGPDASSLGAIKSNTGAEQGAGEGSGDS
SGDRPLEGSPDPTPGEKRGGEEAAVRPDSCLQNPCLNGGTCVEGGPARCFCLSGYGGDLC
QTDLEACESGWDKFQGFCYRHFPRRQSWEAAEQHCRMCGGHLLSVTTPEEQDHVNDKYRE
YQWIGLNDRTIEGDFRWTDGKPLLYENWYHGQPDSYFLSGEDCAVMVWHDGGRWSDVPCN
YHLSYTCKKGASSCGEPPEVPRATAFGKKRLRYETDTKVRYYCEGGYVQQGNPVVRCLPG
GQWEEPLITCVPSNLPPVARSMERRPGHKGHRGHRAGPVSSPCSL
Download sequence
Identical sequences G3Q0T7
ENSGACP00000023482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]