SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

  Home > Genomes > Gasterosteus aculeatus 76_1 > ENSGACP00000023636

Domain assignment for ENSGACP00000023636 from Gasterosteus aculeatus 76_1

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:  ENSGACP00000023636
Domain Number 1 Region: 439-699
Classification Level Classification E-value
Superfamily YWTD domain 3.01e-52
Family YWTD domain 0.0000000553
Further Details:      
 
Domain Number 2 Region: 231-271
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000012
Family LDL receptor-like module 0.00047
Further Details:      
 
Domain Number 3 Region: 145-185
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000772
Family LDL receptor-like module 0.00094
Further Details:      
 
Domain Number 4 Region: 27-64
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000929
Family LDL receptor-like module 0.0008
Further Details:      
 
Domain Number 5 Region: 184-224
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000131
Family LDL receptor-like module 0.00071
Further Details:      
 
Domain Number 6 Region: 103-146
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000144
Family LDL receptor-like module 0.00045
Further Details:      
 
Domain Number 7 Region: 269-309
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000353
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 8 Region: 68-105
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000838
Family LDL receptor-like module 0.00091
Further Details:      
 
Domain Number 9 Region: 393-433
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000401
Family EGF-type module 0.0013
Further Details:      
 
Domain Number 10 Region: 314-350
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000353
Family LDL receptor-like module 0.00035
Further Details:      
 
Domain Number 11 Region: 357-399
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000001
Family EGF-type module 0.0043
Further Details:      
 
Domain Number 12 Region: 702-749
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000345
Family EGF-type module 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000023636   Gene: ENSGACG00000017886   Transcript: ENSGACT00000023682
Sequence length 844
Comment pep:known_by_projection group:BROADS1:groupXIV:10227780:10257484:-1 gene:ENSGACG00000017886 transcript:ENSGACT00000023682 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence 
MITSAPGILLLPMLICLQRCIDVHGTKTECEASQFQCGNGRCIPSVWQCDGDEDCTDGSD
EDSCVGKTCDEVDFVCHNGQCVPKRWHCDGEPDCEDGSDESVEICHMRTCRVNEFSCGAG
STQCIPVFWKCDGEKDCDNGEDEVNCGNVTCAPNEFTCASGRCISSNFVCNGEDDCGDGS
DEVACAPSSCGPSEFQCGNSSCIPASWVCDDDVDCQDQSDESPSRCGRHPTPPAKCSSSE
MQCGSGECIHKKWRCDGDPDCKDGSDEANCPVRSCGADQFRCDDANCILGSKQCNGLRDC
ADGSDEVNCKNMTQCNGPEKFKCRSGECIEMSKVCNKARDCPDWSDEPIKECNHNECLLN
NGGCSHICKDMAIGFECDCTPGLQLIDHKTCGDINECLNPGICSQICINLKGGYKCECHN
GYQMDPTTGVCKAVGKEPCLIFTNRRDIRRLGLERKEYTQIVEQQRNTVALDADFNQQMI
FWADLGQRAVYSTVLDKRGDVGTHNKVIDNVQTPVGIAVDWIYKNVYWSDLGTKTISVAN
FNGTKQKLLFSKGLKEPASIAVDPLSGFLYWSDWGEPAKIEKSGMNGVDRQVLVATDIQW
PNGITLDLIKGRLYWVDSKLHMLCSVDLNGDNRNKVLQSPEYLAHPFALTVFEDRVFWTD
GENKAIYGANKFTGSDVVTLASNLNDPQDIIVYHELIQLSGTNWCAEKGENGGCSYMCLP
APQINKHSPKYTCVCPEGQELAADGHRCRPESNVGTSIQVDSTARGSAAAWAILPVLLLA
MAAGGGYLMWRNWQLRNQKSMNFDNPVYLKTTEEDLNIDITRHGANVGHTYPAISIVSTE
DDLS
Download sequence
Identical sequences G3Q188
69293.ENSGACP00000023636 ENSGACP00000023636 ENSGACP00000023636

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]
Please cite: Gough, J., Karplus, K., Hughey, R. and Chothia, C. (2001). "Assignment of Homology to Genome Sequences using a Library of Hidden Markov Models that Represent all Proteins of Known Structure." J. Mol. Biol., 313(4), 903-919.

Please send feedback, comments or questions to superfamily@cs.bris.ac.uk or use the feedback form.

© Copyright 2013 The SUPERFAMILY authors and Julian Gough.