SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000023675 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000023675
Domain Number 1 Region: 566-629
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000473
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 2 Region: 86-126
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000196
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 3 Region: 494-541
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000051
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Domain Number 4 Region: 34-82
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000654
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 
Domain Number 5 Region: 626-687
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000167
Family Complement control module/SCR domain 0.0039
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000023675
Domain Number - Region: 445-482
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0276
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000023675   Gene: ENSGACG00000017918   Transcript: ENSGACT00000023721
Sequence length 836
Comment pep:known_by_projection group:BROADS1:groupXIV:10379024:10386421:-1 gene:ENSGACG00000017918 transcript:ENSGACT00000023721 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IVCFIYGIKDWAAALSSLTLLVIFWSPVCCQQPVNCRWGAYGEWSECDGCSSTKVQTRHV
EAYAQFGGRPCSGEAERIQPCVPHKGCPLATSCGDRFRCTSGQCISRSLVCNGDQDCEDG
LDERSCDQDGSKYTCDLDKTPPSSDVTGRGYNVLTGKLKAGVINTLSFGGQCRKVFSGSH
KAHYRLPQSILGYSFQVTANNEESDESYESSWSYMQHIQANAMVGHDRRNFHKELTDNKA
YRLIVLKNKVELAQFQNTAPQDLPLAEGFWKALSSLPYTYDYSAYRQLLETYGTHYLSEG
SLGGEYQAFLELDRQALESTQTTNIDYQRCWRKVKRRLFWKKVTTVCEKLTKALSSSHGQ
KVNKMPIKVNVIGGDTTFIAALSLLDLENPERNGEIYENWASSVKDFPEVIDQKLRPLYE
LVKEVQCAGLKRLHLKRATETYLTEEHPCHCRPCQNNGRPLLTGSECRCICRPGTSGQAC
ERGTAIGEQPAGVIHGSWSCWSLWGSCSQGQRSRTRSCNNPAPSRGGQHCSGLQLEQKPC
EDGDIQFLQTMEPQCFNLSVISPKTCGAPPNLRNGFIQNPRDVYLVGNIVEYSCIPHYYL
SGDARAHCTENQNWRRGFLVCKSSTCGIPPLNGQVIATPTQAAYQIGDRVSLSCPVGSVL
DADVSEIMCSSSLQWSPSPSSAHCKAAPSAPSPPSGLQCKPWEDVGKTECVCKMPSQCPV
SLKLCARLGSSRTRLLSVCQLGALRCNGRSFELANDSDCVWPEETSASCAQCTPGTICQE
SKCVCQNKTECPNDSARLCVRSGVDSVAIAMTECEVGARRCAGENVNVFSIEACPE
Download sequence
Identical sequences G3Q1C7
69293.ENSGACP00000023675 ENSGACP00000023675 ENSGACP00000023675

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]