SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000023695 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000023695
Domain Number 1 Region: 211-326
Classification Level Classification E-value
Superfamily EF-hand 1.35e-32
Family Osteonectin 0.025
Further Details:      
 
Domain Number 2 Region: 298-394
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 1.07e-29
Family Thyroglobulin type-1 domain 0.00066
Further Details:      
 
Domain Number 3 Region: 147-191
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000347
Family Ovomucoid domain III-like 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000023695   Gene: ENSGACG00000017934   Transcript: ENSGACT00000023741
Sequence length 454
Comment pep:known_by_projection group:BROADS1:groupIV:10439115:10505618:1 gene:ENSGACG00000017934 transcript:ENSGACT00000023741 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLFLLPAVALLLSRESTVSGSGTDKWLSTVAQYKDRSWNRFRDDDYFKSWAPAKSLDQE
REVEPGRQGDPGTKAHSGSAKKTAQDGPDATKDPCLKVRCPPHKVCVSHDYQTAICTNHK
QPPHSVKPRKGGAGHKHRLEAGAHGKCRPCSGIQSGPVCGSDGHTYSSWCKLEFQSCLSG
KTISVKCDGPCPCLPGQQPSKPPHKTDKAGTDTQLHSLAARLKDWFGVLHLDANRDLKSS
DSFDSTAGHFDTSILPICKDSLGWMFNKLDMNFDLLLDQSELSAIYLDKYELCMKPLFNS
CDSFKDGKLSNNEWCYCFQKPEGLPCQAEKSIIQNQSRRKSLIGFYIPRCTEEGYYKPTQ
CHGSTGQCWCVDKYGNEIAGSRKQGNPNCDEDQETSGDFGSGGAVILLDDQEEEPSRSGR
SRQNKRRGRIHPRGAIEDDEDEEDDKDDEIGYVW
Download sequence
Identical sequences G3Q1E7
69293.ENSGACP00000023695 ENSGACP00000023695 ENSGACP00000023695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]