SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000023821 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000023821
Domain Number 1 Region: 105-223
Classification Level Classification E-value
Superfamily EF-hand 1.29e-30
Family Osteonectin 0.012
Further Details:      
 
Domain Number 2 Region: 192-286
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 3.14e-25
Family Thyroglobulin type-1 domain 0.00068
Further Details:      
 
Domain Number 3 Region: 45-91
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000107
Family Ovomucoid domain III-like 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000023821   Gene: ENSGACG00000018028   Transcript: ENSGACT00000023868
Sequence length 313
Comment pep:known_by_projection group:BROADS1:groupIX:9647600:9650992:1 gene:ENSGACG00000018028 transcript:ENSGACT00000023868 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IKCSRHKVCVSEDYKTATCVSQRRVRNTITTVAENSSVYQSPGSKCKPCPVVHPSPVCGT
DGHSYSTKCKLDYQACITGKKIAVKCSGMCPCPSQPEQSSAEKKVCSESDLKEVVNRLRD
WFRVLYENGNHKRVKIQKPEKNKFEVGTSPICKDPVGWMFPRLDTNFDVQLDQSEIKSLY
LDRNEPCSDAFFKSCDTHMDKVITSSEWCTCFQRYTDSPCKEELSSINKKQAGKKVIGQY
LPSCDEEGYYRSHQCHSSSGQCWCVDRYGNEDASSRTHGPANCGVILESSGDLGSGDSLF
SDDDEDSFVLNDQ
Download sequence
Identical sequences G3Q1S3
ENSGACP00000023821

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]