SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000023933 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000023933
Domain Number 1 Region: 563-717
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.16e-34
Family MAM domain 0.00051
Further Details:      
 
Domain Number 2 Region: 721-879
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.04e-26
Family MAM domain 0.001
Further Details:      
 
Domain Number 3 Region: 267-427
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.06e-25
Family MAM domain 0.011
Further Details:      
 
Domain Number 4 Region: 884-1053
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.08e-21
Family MAM domain 0.0085
Further Details:      
 
Domain Number 5 Region: 54-221
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.07e-21
Family MAM domain 0.0024
Further Details:      
 
Domain Number 6 Region: 226-262
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000262
Family LDL receptor-like module 0.0017
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000023933
Domain Number - Region: 457-481
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00471
Family LDL receptor-like module 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000023933   Gene: ENSGACG00000018113   Transcript: ENSGACT00000023980
Sequence length 1055
Comment pep:known_by_projection group:BROADS1:groupXIV:11278595:11287976:-1 gene:ENSGACG00000018113 transcript:ENSGACT00000023980 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFPWRSSALALLLTLHFATGSRAAICQTPENACDFVCDCDDCIDEQDCGYSGRGFTCDFE
AAGMCGWTDQSSNAAVYSWQRRQREGSALPDSGPTSDYSTGTAAGWFVGVSALTAGSLST
AVLISPEMKQSSPTCRLRLRYFLWDSGHTGLGSTPLWASILRHDSRETVVWRPEATSVRG
WREDTVFLGRIPTGFRIRLHSRRSAGQTGDVAVDQLEFLDCALPCKECPPGMTGCERGGC
VEQRQICDGSDDCGDGTDEKTCDGCEVCDFEQDVCRWDLRTFSKLEWVRTNQVNISVTDP
LMGPGRDHSNNSATGHFLYVTVPDGGLTSDWAVFQSPRLEPTNITQPCKMVMYTHQFGPR
SGGLSVLVAGREISPVWQRGGALGDVWVKAQVDIVADSIFQILIVAAVRNFAYGGIAVDS
IALSPGCRLSSEKCSTSAKIENAGNGTWPSFPKPPKTLCAEPDKMCDFHGDCAGGEDEDK
CGDFSSTEGSSGWTDASIGSQGWVLHKNETAKGTTQESLEDYLYVSEAPGQQLTEAQTRT
PLLGPSGPACTLSCNDNYFPSSPTGLSCNFEDGLCGWYQDHSDDFDWALMNGTDHTIGIG
SSLVVDMWSPSLRGAFGRLVSYSQLPVASDHCLSFFYKLYGPNAGTLNVKLLLTDGYEAV
LWTRSAAQGNVWHEAHCPVPHQLTNFQTSHQLLFEAVRSGFDGRVAVDDVAFVEGPCAAP
RVCSFEGQRCGYSSSGKVQWLHRSGSTVTLTGPETDHTLETELGFYMLVNTGKNFLPSGG
TSVLNSPVRQGNGRTECVHFWYHMGGANPGSLTLFMKPVKGERVKIFSDSLDQGDVWRHG
NGNISSALMDWQLEFEVVGAGGVDTHVAVDDIFLSAHPCEDRGSKCSLERGMCSWSNTQN
ANADKLDWELTSPEAESHYPIPPEDHSLGTEKGHFLFFPSSNRTAANENAQLLSPHLPPT
KSTCLKFWAYKPYSLFFNTCTHFRTYAADSQLRVWRLSQGRLHQLLVVSELGGPWKRFDV
NITSDEEYQIVLEGIKGTSGVVALDDIEYTDGVNC
Download sequence
Identical sequences G3Q234
69293.ENSGACP00000023933 ENSGACP00000023933 ENSGACP00000023933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]