SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000024414 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000024414
Domain Number 1 Region: 88-378
Classification Level Classification E-value
Superfamily DNase I-like 5.23e-40
Family DNase I-like 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000024414   Gene: ENSGACG00000018465   Transcript: ENSGACT00000024463
Sequence length 388
Comment pep:known_by_projection group:BROADS1:groupIX:12301295:12303829:1 gene:ENSGACG00000018465 transcript:ENSGACT00000024463 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QSVCPMGGGATRLYGALTQSSSSSPPPLPPPADTNLDPPFCQGQKASPPCPPTPAELLRQ
CEEALRDRPPRLHRKFTHLNDGDSGSSSSIRVMQWNILAQALGEGLDCFVQCPPEALSWS
RRKYLILEEILTYRPHILCLQEVDHYHDTFQPVLEGLGYSGSFCPKPWSPCLQVEGNNGP
DGCALFFDRSRYECLDSVNLKLSALRIPTNQVAVVTMLRCRSTGRCACVAVTHLKARSGW
EWLRSTQGSDLLRHLQNLVQKHAGEPAAAPGSDIPLLICGDFNAVPTEEVYQRFIASPLR
LESAYKKLSQDGLTEPEYTTWKIRPTGECCSTLDYIWYSQDTLRVDSVLEMPTEEQIGPN
RLPSFSYPSDHLSLVCDFSFKENLRELW
Download sequence
Identical sequences G3Q3G2
ENSGACP00000024414 69293.ENSGACP00000024414 ENSGACP00000024414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]