SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000024478 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000024478
Domain Number 1 Region: 85-153
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 6.63e-19
Family Complement control module/SCR domain 0.00063
Further Details:      
 
Domain Number 2 Region: 265-336
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.26e-16
Family Complement control module/SCR domain 0.00065
Further Details:      
 
Domain Number 3 Region: 200-263
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000275
Family Complement control module/SCR domain 0.00081
Further Details:      
 
Domain Number 4 Region: 142-203
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000178
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 5 Region: 25-90
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000135
Family Complement control module/SCR domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000024478   Gene: ENSGACG00000018516   Transcript: ENSGACT00000024527
Sequence length 351
Comment pep:known_by_projection group:BROADS1:groupIX:12782664:12786527:-1 gene:ENSGACG00000018516 transcript:ENSGACT00000024527 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERPLALILLFPFLYFPTAASDNVCLRPELADNIEKDGLQRYFSPGVELTLSCKQGYSPE
LGPRKIVCGISGEWTKTRLMCSPKRCPYPDSLSNGESYYEDIMFQSTINYTCNEGYTLTG
NRSATCLSNGEWSTPVPQCKPVTCGLAPIPQFGKIIYDKRIRGNTTYYGLKGTYTCLPPY
VLFGSARGECTVSGEWTKAPECRVVTCPAPENIDMGFLSSNEERDYDYKETVRYGCNEDY
VLDGNFQIVCNQDGNWSKKPSCKAPCRVGLERARILYKEKKIWIEDLNPNRVLHNEIISF
YCMDMDRQCGYAVSTQCIEGKLKIPECFELEPSAIHYKLQSSSLPSEMKQC
Download sequence
Identical sequences G3Q3M6
69293.ENSGACP00000024478 ENSGACP00000024478 ENSGACP00000024478

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]