SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000024479 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000024479
Domain Number 1 Region: 265-337
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.04e-17
Family Complement control module/SCR domain 0.00049
Further Details:      
 
Domain Number 2 Region: 86-154
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000432
Family Complement control module/SCR domain 0.0026
Further Details:      
 
Domain Number 3 Region: 207-267
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000123
Family Complement control module/SCR domain 0.0008
Further Details:      
 
Domain Number 4 Region: 25-91
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000275
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 5 Region: 143-216
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000195
Family Complement control module/SCR domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000024479   Gene: ENSGACG00000018518   Transcript: ENSGACT00000024528
Sequence length 359
Comment pep:known_by_projection group:BROADS1:groupIX:12786996:12790183:-1 gene:ENSGACG00000018518 transcript:ENSGACT00000024528 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALALALLVLCQAALHTTVTSKSVCGRPFVSDGIEQSTLKRVYEVGEELTPACERGYLPS
TATPRRMTCTGTGEWTQSDLACSPKMCPIPRPLQPLAKGRTEAPFKSVLNYTCDAGYVML
GANESRCLHDATWSNPPPLCKAVNCPLPKPPRDGRIAYDKPFTGSTTVYGQGWTYECNPR
MAPSFERGSCMADGSTTEPPVCREVSCAAPTGIPNGFVTFAVIRRHGYKETVKYACNDHY
TMDGEVEIRCQNTGNWSAKPVCRAPCAVGIKRGRIFYNAKKLWIADLKPNRVLHGEHVGF
YCLNREERCGYTAVSTCNDGTLPIPECFEEPGKVEYTLRAKSLPSEITMCAASPSARPA
Download sequence
Identical sequences G3Q3M7
69293.ENSGACP00000024479 ENSGACP00000024479 ENSGACP00000024479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]