SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000024505 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000024505
Domain Number 1 Region: 1232-1295,1328-1408,1448-1551
Classification Level Classification E-value
Superfamily YWTD domain 4.84e-24
Family YWTD domain 0.013
Further Details:      
 
Domain Number 2 Region: 905-981
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00000129
Family Pre-dockerin domain 0.096
Further Details:      
 
Domain Number 3 Region: 1228-1289,1517-1757
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0000157
Family Quinoprotein alcohol dehydrogenase-like 0.038
Further Details:      
 
Domain Number 4 Region: 706-731
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000921
Family Integrin beta EGF-like domains 0.068
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000024505
Domain Number - Region: 640-665
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000419
Family Integrin beta EGF-like domains 0.078
Further Details:      
 
Domain Number - Region: 737-762
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00251
Family EGF-type module 0.088
Further Details:      
 
Domain Number - Region: 573-599
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00569
Family Integrin beta EGF-like domains 0.06
Further Details:      
 
Domain Number - Region: 544-567
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00921
Family EGF-type module 0.049
Further Details:      
 
Domain Number - Region: 608-632
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0218
Family EGF-type module 0.025
Further Details:      
 
Domain Number - Region: 772-807
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0764
Family Integrin beta EGF-like domains 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000024505   Gene: ENSGACG00000018534   Transcript: ENSGACT00000024554
Sequence length 2749
Comment pep:known_by_projection group:BROADS1:groupIV:15373076:15510407:1 gene:ENSGACG00000018534 transcript:ENSGACT00000024554 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEMDSKPYQPLSKGRHEMEMSYTSSSDESEDGRAHHRSYTSRETLPDYTHELRLTLGSH
RDRQSNYSQPQPELDFCKEGEEEALCSGPAAHCHSRYSLGVGSDVDTEPEADPSPALGLQ
HMWMRGLKSGQSSCLTSRANSALSLTDTEHDRKSEPDNGNLRESLGCACLRTGSTQGCQL
PSSPGGQFTFRPLPPPPPPPHACTCARPAPYTQVSLQRKTMPTRCQASQGGQGPDTGAST
DQAQLHNSWVLNSNIPLETRHFLFKQGSGSSALLSGAGQGYPLTSGTVYSPPPRPLPRSS
VTRPLFTFNKPHRCCNWKCTALSASLLTLTLALLLTYVIAVHLLGLTWHLRHGESQLYEN
GLSSADHQQEDRSKSRPTSSIHLLDTLNPENTHAGDKEKWVRGRAIDRGEVDVGTQQSQA
IPPGLFWRFHMNVHHPTYIKFNLSLSHNALIGVYGRRNIPPTHTQFDFVKLLDGKALPWS
LTDPVSSAKVPKGLLLSGLQETGFIEYMDPFTWHLALYNDGRNLEQVLLHSTPIDSMDGC
STDCNGNGECVAGHCHCFAGFLGPDCAKDSCPVLCSGNGVYEKGRCACLAGWKGAECNVE
EGQCIDPTCSNHGSCIQGICICGPAYKGVNCEQVDCVDPQCGGHGVCVRGECVCSAGWAG
LSCDEPLPACQEQCSGHGTYLPESDACACQPNWTGPDCYTELCLVPCGSHGVCSEGQCQC
EEGWIGAACDQRACHARCEEHGQCHDGTCICQPGWEGEHCHMGELCECAWEYGCPGLCSG
HGRCTLEQSGWRCICQAGWSGPGCSVVMETDCSDGTDNDGDGLMDCVDPDCCEQLSCGSD
PLCHGSTDPMALLQQRPPPPAASSSSPTSTHTHSFYRRIRFLLGKAATHTLPGDVPFDTS
RVAVIRGSVAVQDGSPLVGVNITFPQHPEYGYTISRQDGSFDLVTLGAMSMTLMFQRPPF
LPQTRTIWTPNNNFLVLDQVTMSREEAQTPTCDIRSVLSPYPLVLPYPLPRYTGACAEKG
PAVPELQAVQEEVSIPGAYMKLSYLSTRSAGYLSLLRILLTPPSLLSPTSPLGGLSKVHV
RTAVQGRLYQRWYPAGPGLVHRLVWNKTDIYGQEVWGLTHATVSVGYEYESCPGVVQWER
RTALMQGFELVPSNLGGWSLDKHHALNIRSGILHKGNGENVFLSQQPPVISTVMGNGFYR
SVPCGPSCSGAARDMMLFAPVALASGPDGSLYVGDFNFIRRVHPDGYTRTILELNTSPAH
KYYLAMDPMGEVLYVSDTSSRRVYRVRNLGQPKDPSRNLEVVAGTGEQCLPFDQTHCGEG
RKAAEAALNNPRGIAVDKRGVVYFVDGTTIQKINERGLLSTVIGSNGLMSTQPLSCDARM
DIGQVRLEWPTDLAINPLDNSLYILDNNIVLQVSENLQVRIVAGRPIHCQVPGIDHHLVR
WAAVRATLEAAKAIALSHLGTLFIAETDERRINRIQQVSTNGEISVISGAPTDCDCKIDP
NCDCFSGDGGYARDARLKAPSSLAVAPNGTLYIADVGNIRIRAVSPNQPQPSPVGLMEIS
SPLDQELYLFSQNGSHMHTKHLITGHYLYNFSYVSDGQLSGLTSRDGRGLQVRRDARGVP
LWLALPGGQVYWLSLSNSGTLRKVSAQGHDIAHITYHGNTGLLATKSDENSWTTVYEYNS
EGRVTNITLPTGEVSGFHGNLERWSRVEVDASTRENFVTSTNLSASDTIYTFRQDHAQSS
YRVSADGSFLVTLASGMELSLITEPLLPGGTGGGVSPTASRCNISLPGDHAPSLIEWRQR
KEQSKTNYSTYERRLRAHNRNLLSIDFDQSTRVGKIYDDHRKFTLHIQYDSLGRPVVWSP
SSKYTEVNISYSAGGLLSSIHRGVWSERLEYENDRVVSRAWVNGKIWSYTYADKSIMLLL
HSQRRYVFEYDQSDRLVAVTMPSMVKHSLQSLLSIGYYRNIYTPADSQSSFMQDYTLDGR
LLRTQYLGTGRSVIYRYTPAARLSEVVYDSTLVTFTYDEASGTVKTIHLTHNGFISSIRY
RQTGPLTSRQIFRFSEEGLVNARFDYSYNNFRVTSMQAVINETPLPIDLYRYVDVSGRVE
QFGKFSVIFYDLNQVITTHLMKHTKVFNSYGQVVEVQYEILKSIAYWMTIQYDSAGRTTT
CDIRVGVDNNVTRYTYEYDADSQLQSASVNERPQWRYSYDLNGNINLLSHGTSARLTPLR
YDQRDRITHLGELQYSVDEDGFLRQRANDLFDYNSNGLLTRVFNRVTDRAVWYRYDGLGR
RVATKSSQGEQLQFFYADLSHPTRVSHLYNHSSNLITSLYYDLQGHLIAMELSSGEEYYV
ACDSVGTPRAVFSSKGRLVKEILYTPYGEVYQDTNPDFQLVIGFHGGLYDPLTRLVHLGR
RDYDTLAGRWTCPNHELWGELSKEPKPFNVYAFKNNCPVGKVEGVTEFTTGIGSWLQLFG
FQLHNVVPGFPKPEVGRMEQTYELMKTQTKTQDWDSSKVVLGIQCELRRQLRSFISLERL
PLVSEPVGSTRHRPTSPPPFASRPSLLGPSIRFAVSHGHVSAEVIGVASEDSRRVAAILN
GAVHLSGLSFTVHGCDTHHFLQSRPIEEDLALGLGVGGRVLESGVNVSVSQMSATVSGRT
RRFADITLQQGALCLCVRYGGSEEEERARVRDEARKRAVEGAWQKERMRADLGDVGSRAW
SEAEKQQLLSAGLVQGYDGYYSLPTEQQPELSDCPSNIHFMTLSEAGGR
Download sequence
Identical sequences G3Q3Q3
ENSGACP00000024505 ENSGACP00000024505 69293.ENSGACP00000024505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]