SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000024685 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGACP00000024685
Domain Number - Region: 3-48
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00299
Family Laminin-type module 0.057
Further Details:      
 
Domain Number - Region: 520-569
Classification Level Classification E-value
Superfamily EGF/Laminin 0.012
Family Laminin-type module 0.033
Further Details:      
 
Domain Number - Region: 260-309
Classification Level Classification E-value
Superfamily EGF/Laminin 0.014
Family Laminin-type module 0.05
Further Details:      
 
Domain Number - Region: 481-526
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0322
Family Laminin-type module 0.053
Further Details:      
 
Domain Number - Region: 133-180
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0511
Family Laminin-type module 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000024685   Gene: ENSGACG00000018673   Transcript: ENSGACT00000024734
Sequence length 594
Comment pep:known_by_projection group:BROADS1:groupXIV:15191135:15206964:1 gene:ENSGACG00000018673 transcript:ENSGACT00000024734 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SRCQCQNGALCNPITGACICTPGYRGWRCEAQCEVGTYGNGCQQKCQCQNGASCHHLTGE
CNCSSGYNGALCQDHCPVGTYGAGCAKKCRCENYSKCYYTNGQCLCEPGYTGETCNARLC
PEGHYGLRCDRKCLCYAQNTRSCHPMSGECSCQPGWSGLYCNEMCTAGFYGESCQQVCQC
QNGADCNSVTGACICTPGFTGPNCSVPCPTGTHGVDCFSHCNCKNKAQCSPVDGSCSCKQ
GWHGVDCSINCPSGTWGVGCNLTCMCGKGGSCNALNGQCTCAPGWRGERCELRCQDGTYG
LDCKARCHCSNADGCHHSTGHCRCLAGWTGIHCDSVCTQGRWGPNCSLPCNCKNGAFCSP
DEGTCACAPGYRGTTCQRICSPGYFGHRCSQTCPQCAHSNGPCHHVSGQCDCLPGFKGAL
CNEVCPSGQFGKNCAWSCSCTNNGTCSPIDGSCQCYPGWIGSDCSQPCPPVQWGPNCIHT
CNCHNGAYCSAYDGECKCTPGWTGLYCTQRCPLGFYGKDCSLTCQCRNGANCDHISGQCT
CRTGFMGRDCEQRCPPGSYGYGCRQVCDCLNNSTCDHMTGTCYCNPGWKGARCD
Download sequence
Identical sequences G3Q481
ENSGACP00000024685

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]