SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000024822 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000024822
Domain Number 1 Region: 43-84
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000134
Family EGF-type module 0.0093
Further Details:      
 
Domain Number 2 Region: 1-34
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000409
Family EGF-type module 0.013
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000024822
Domain Number - Region: 364-630
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000623
Family Rhodopsin-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000024822   Gene: ENSGACG00000018777   Transcript: ENSGACT00000024871
Sequence length 650
Comment pep:known_by_projection group:BROADS1:groupIX:14438109:14445293:1 gene:ENSGACG00000018777 transcript:ENSGACT00000024871 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DVDECGDRPCGNNTNCKNTLGSFNCQCEKGYREKSGLVNFTLNGQCQDINECRDGGNICG
PNASCSNTLGSYKCLCHFGYTEATNHSGHCTAWFCHRSPTYSKPQGQLRPLLVQISAPNN
ASNWFPANRISSTGSDIIIKLTIIKHCGFSLGKLNRLFIFSQSLGGLAGILSMIRSSCLA
LSDPSVAGEGKSDGEVLLKRGQTPPTGPIHLTNDNATLDTDWTTAAGTGSYPVCFTGFAL
AALLSYKNLEISDNRSFSELTGLEKDGVSPSFQVTSTIVSVVVSNPSTQNLSRSVNITLR
HLQNITGDVSYICAYWNESGAWSTDGCYQRTSNKTHTECTCSHLSSFAVLVALYDMKETK
LQLVTKIGLTISLLCLGLCILTFKFCRSIQGTRTTIHLHLCICLFVADLIFLAGISQTEP
VGACRFVAAMLHYFFLGVFTWMLLEGVQLYRMVVLVFNATMRPLYLILTGYGTPLIIVII
SAIIRPNGYGTDQHCWLSLEDGLIWSFYGPVCFIVILNVFFFIVTVWKLAQKFTSLNPDL
TKLHKIKAFTVTAIAQMCILGLMWVFGAFLFQEGTLVAAYIFTILNSLQGALVFIMHCLL
SKQVREEYAHFLSCICTSEKKRYSDLTSTNPSNMSLSSQQRSSRPQQVSI
Download sequence
Identical sequences G3Q4L8
69293.ENSGACP00000024822 ENSGACP00000024822 ENSGACP00000024822

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]