SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000025144 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000025144
Domain Number 1 Region: 1232-1459
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.16e-40
Family Laminin G-like module 0.0028
Further Details:      
 
Domain Number 2 Region: 278-390
Classification Level Classification E-value
Superfamily Cadherin-like 1.43e-30
Family Cadherin 0.00057
Further Details:      
 
Domain Number 3 Region: 383-488
Classification Level Classification E-value
Superfamily Cadherin-like 9.55e-29
Family Cadherin 0.00096
Further Details:      
 
Domain Number 4 Region: 694-806
Classification Level Classification E-value
Superfamily Cadherin-like 2.57e-28
Family Cadherin 0.00079
Further Details:      
 
Domain Number 5 Region: 65-168
Classification Level Classification E-value
Superfamily Cadherin-like 6.15e-26
Family Cadherin 0.0019
Further Details:      
 
Domain Number 6 Region: 170-276
Classification Level Classification E-value
Superfamily Cadherin-like 2.09e-25
Family Cadherin 0.0016
Further Details:      
 
Domain Number 7 Region: 1482-1673
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.76e-25
Family Laminin G-like module 0.019
Further Details:      
 
Domain Number 8 Region: 591-692
Classification Level Classification E-value
Superfamily Cadherin-like 4.14e-25
Family Cadherin 0.0029
Further Details:      
 
Domain Number 9 Region: 794-910
Classification Level Classification E-value
Superfamily Cadherin-like 3.57e-24
Family Cadherin 0.0011
Further Details:      
 
Domain Number 10 Region: 488-589
Classification Level Classification E-value
Superfamily Cadherin-like 9.42e-23
Family Cadherin 0.0015
Further Details:      
 
Domain Number 11 Region: 2265-2527
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000000011
Family Rhodopsin-like 0.025
Further Details:      
 
Domain Number 12 Region: 901-1004
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000243
Family Cadherin 0.0068
Further Details:      
 
Domain Number 13 Region: 1172-1211
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000931
Family EGF-type module 0.0096
Further Details:      
 
Domain Number 14 Region: 1813-1853
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000444
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 15 Region: 1684-1717
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000712
Family EGF-type module 0.016
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000025144
Domain Number - Region: 1863-1914
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.000615
Family Hormone receptor domain 0.0079
Further Details:      
 
Domain Number - Region: 1724-1759
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000681
Family EGF-type module 0.017
Further Details:      
 
Domain Number - Region: 1151-1176
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00293
Family EGF-type module 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000025144   Gene: ENSGACG00000019020   Transcript: ENSGACT00000025193
Sequence length 2764
Comment pep:known_by_projection group:BROADS1:groupIV:20755278:20823119:-1 gene:ENSGACG00000019020 transcript:ENSGACT00000025193 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCMEQRAQPEGSLRCALRSSAGGRLSVQLSVTIVKVPKQHGSVPESIRRNSGQMIRRGKR
QVNASPQFQLPNYQVSVPENEPPGTRVITLKATDPDDGEGGRLEYSMEALFDVRSNDFFN
IDPQSGSITTVQSLDREVKDTHVFKVTVMDNGSPKRSATSYLTVTVSDTNDHSPVFEQTE
YRVSIRENVETGFEVMTIRATDGDAPSNANMIYKLVNGDGVNSVFEIDPRNGLVRIRERP
DRETRAKYQLIVEANDQGKDPGPRSATATVKISVEDENDNYPQFTKKRYVVEILENVSVN
TKVIQVEATDKDEGNNAKVHYSIISGNVKGQFYIHSPTGVIDIINPLDYEMIREYNLRIK
AHDGGRPPLINGTGMVVVQVVDVNDNAPMFVSTPFQATVLENVAIGYSVIHIQAIDGDSG
YNALLEYRLTDTVPGFPFTINNSTGWITVSEELDRETTDFYTFGVEARDHGIPVMSSSAS
VSITVLDVNDNVPTFTEKVYSLKINEDAVVGTSVLTMTAVDRDINSVVTYQISSGNTRNR
FAITSQSGGGLVTLALPLDYKQERQYVLTVTASDGTLYDTAQVFINVTDANTHRPVFQSA
NYQVMLCEEKPVGATVVMIIATDEDTGENARITYLMEDNVPQFKIDPDTGAITTQMEIDY
EDQASYTLAIIARDNGIPQKSDTTYVEIIILDANDNTPQFLRDRYQGTVFEDAPVYTSVL
QISASDRDSGSNGRVSYTFTGGDDGEGDFFIEPYSGIIRTARKLDRENVPVYNLKAYAVD
RGVPPLKAAVVIHVVVQDINDNAPVFEKDELFIDVEENSQVGSIVARISATDPDEGTNAQ
IMYQIVEGNIPEVFQLDIFNGDLTALTDLDYEVKTEYVLVVQATSAPLVSRATVHIRLVD
MNDNKPVLQDFEIIFNNYITNKSNSFPSGIIGKVPAHDPDVSDKLRYRFESGNELNLLLL
NENTGDLRLSRDLDNDRTLEAPMTISVSDGVHRAVALCTLRVTIITDDMLTNSITVRLEN
MSQERFLSPLLSLFLEGVAAVLSTKREAVFVFNIQNDTDVQGSILNVTFSAMQPGGAAGK
GTFFPSEELQEQIYLNRTLLRLISSQEVLPFDDNICLREPCENYMKCVSVLKFDSSPPFI
ASDTVLFRPIHPINGLRCRCPLGFTGDYCETEIDLCYSGPCKNNGRCRSREGGYTCECPE
DFTGEHCEANASSGRCEPGVCKNGGRCVNRLAGGFMCQCTPGEFEKPYCEMTTRSFPGQS
FITFRGLRQRFHFTVSFTFATRERNALLLYNGRFNEKHDFIALEIIDEQIQLTFSGGETK
TTVSPYIPGGVSDGQWHSVQLHYYNKPNIGRLGIPHGPSGEKVAVVAVDDCDISMAIRFG
KQIGNYSCAAQGTQTGQKKSLDLTGPLLLGGVPTLPEDFPVWNRDFVGCMRNLSIDSRPI
DMASYIANNGTEAGCPAKKNFCISDLCQNGGVCVSKWDTYSCECPTGYGGKNCEQVMPSP
QFFDGQALVSWSETDVTVAVPWYMGLMFRTRQPAGTLMQANAGAHSTINLMVSERQIRME
VFLRQELVASLSFPQVRVNDGEWHHLLVELRSAKDGKDIKYVAYVSLDYGMYQQKSVELG
NDLPGLKLQTLHVGGLPGEGNQVRNGFVGCIQGVRMGETSTNVANVNMAQGLKIRVEDGC
DLADPCDSNICPENSHCSDDWSTHTCVCDPGYFGKECVDACQLNPCEHVSTCVRKPSSSH
GYTCECGQNHYGQYCENKIEKPCPQGWWGSPMCGPCNCDINRGFHKDCNKTTGECRCKEN
HYRPEGEDTCYPCECFSVGSESRTCDGVTGQCPCKGGVIGRQCNRCDNPFAEVTPTGCEV
VYEGCPKAFDAGVWWPKTKFGRPAAMNCPKGSVGTAIRHCNDEKGWLSPELFNCTTVSFS
HLKKLNEDLRRNSSRMNCEHSKAIVRLLHSATNSSQRYYGNDVKTAAQLLNHVLQYESLQ
EGFDLTAMRDADFNENLVRAGSAILDPDTKEHWEQIQKTEGGTAHLLRNFEDYANTLARN
VRKTYLKPFTIVTDNMILTVDYLDVSDPQRATLPRFQDIQEDYSKELGSSVQFPRFNPRT
QGNRGPPRQTDPPQEEEHTVSERRRRHLEPAAPLPVAVVIVYKSLGKLLPERYDPDRRSL
RLPNRPVINTAIVTATVHSEGPPPPPVLEPPITLEYTMLETEERTKPVCVFWNHSLTIGG
TGGWSAKGCEVLNRNNSHISCQCNHMTSFAVLMDISKREHGDVLPLKIVTYTTVSVSLFL
LLLTFILLCLLRRLRSNLHAIHRNLVAALFFSELVFLLGINQTDNPFVCMVIAILLHYFY
MCTFAWMFVEGLHIYRMLTELRNINHGHMRFYYAMGWGIPAIITGLAVGLDPQGYGNPDF
CWLSVHDTLIWSFAGPILVVVLVNIVIFILAAKASCGRRQKAMEKSGAIPALRMAFLLLL
LISATWMLGLLAVNSDVLTFHYLFAGFSCLQGVFIFFFHVIFNNEVRKNLKNIFTGKKSV
PDESSTTRASLLTRSLNCNNTNTEDGQLYRSGIGESTVSLDSTLREESGQKPSVSSGTAK
GYTDLDGPLFHRNGTNQADSDSDSELSVDEHSSSYASSHSSDSEDDDMDVKPKWNNERQP
VHSTPKVESVSNHVKPYWPTEATTASDSEDPGGAERLRVETKVNVELHPENKLNHVGERE
RETLPERDKQTAGNARDAAPASQPQGNSNHQPEQRRGILKNKISYPPPLTDKNMKNRLRE
KLSD
Download sequence
Identical sequences G3Q5I8
69293.ENSGACP00000025144 ENSGACP00000025144 ENSGACP00000025144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]