SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000025349 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000025349
Domain Number 1 Region: 30-103
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000129
Family Complement control module/SCR domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000025349   Gene: ENSGACG00000019173   Transcript: ENSGACT00000025398
Sequence length 267
Comment pep:known group:BROADS1:groupIV:22128590:22135140:-1 gene:ENSGACG00000019173 transcript:ENSGACT00000025398 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLHCRFAFSSVCLMVTCLLQSRHCSTDKINCPCPQIPPRLLTLPPDTCFQIDQTFRYVC
QEGYLRKVGTSNLIKCKQDGNNPPEWIPHEPSLKCIPDPKPQPPKSTVTTRSAHCCSAEP
NTTTTQQAESTVTTATSSGPQTTQKLSPSPSVAAEPDRPEPTPLGLLALPGPSQATERVV
TETEATLSTSSTAAPLNGSTHNPQAFPPAAHTAVGCGSLAIVCASMGIGFFCHRRRSKSH
TLTPEEQMPMNGVQSDKETASNSATSQ
Download sequence
Identical sequences B2BHG4
ENSGACP00000025349 ENSGACP00000025349 69293.ENSGACP00000025349

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]