SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000025392 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000025392
Domain Number 1 Region: 96-160
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000945
Family Complement control module/SCR domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000025392   Gene: ENSGACG00000019206   Transcript: ENSGACT00000025442
Sequence length 327
Comment pep:known_by_projection group:BROADS1:groupIV:22515061:22527565:1 gene:ENSGACG00000019206 transcript:ENSGACT00000025442 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLKVGPAAQSAGSLLLVLLWPLLCALVLAGSSTVSHVDPQSPAATSPPEDWTGTAIRLQ
PDLQTETLVLTEAQTEAQTEALPTQSTTSNYTGLCCIPVLPPRRGSFYVETGTGMSIGSV
LAFWCREGYQLVGSDKIYCNVRNGKPQWSNYLPVCEAIPRPEDRGLRVAVLASVVSGIVI
LAMSLSFLICCLQERSSRYRAKKEGRTRRRDKLSSRRSECWMEREEGEWQAFPPPKIFHL
SQRMNPRLAPDSPLYLTAGLGGYENRGYQRSQESLLKASLPGVYRSESQLYPHVVLQRVP
TPTAPSAPSAPSAPLYLHLPSSASSPA
Download sequence
Identical sequences G3Q684
ENSGACP00000025392 ENSGACP00000025392 69293.ENSGACP00000025392

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]