SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000025427 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000025427
Domain Number 1 Region: 1776-1899,1927-1964,1998-2079
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.78e-32
Family Tandem AAA-ATPase domain 0.021
Further Details:      
 
Domain Number 2 Region: 1451-1507,1622-1825
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.95e-22
Family Tandem AAA-ATPase domain 0.056
Further Details:      
 
Domain Number 3 Region: 2110-2331
Classification Level Classification E-value
Superfamily DNase I-like 8.24e-19
Family DNase I-like 0.06
Further Details:      
 
Domain Number 4 Region: 2-182
Classification Level Classification E-value
Superfamily Cysteine proteinases 0.0000000000706
Family M48USP-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000025427   Gene: ENSGACG00000019238   Transcript: ENSGACT00000025477
Sequence length 2332
Comment pep:novel group:BROADS1:groupIV:23078283:23085352:-1 gene:ENSGACG00000019238 transcript:ENSGACT00000025477 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VRASRSQASIRYGRSRNRQCTCNSLTFLAFLHENESITRADLDHVLDKGNTMYRETRKQV
TNHIYLTTDELTDEVPARSATHHADMTQLSRYGTLGEPLPGAVDSFLDLESGLSCLLSDV
KYALLLMRLLCIAVFRTKSGRYGFFDPHSRTARGLPLPAGSRTPGTAVMVTFSRLSDMID
RLKKSHRMMDTQSSCNYELKPVEFYNVNTVNLNGGLPNTDCRPTAVPVDESNSPIATDQT
SSPETTPHTPAVNQPEVLITTSSHDAPHTESESTAQVINPVLSDPSDDILTAESSDIIFT
SSVRQQEVINSNEPELSTKSTFLPSHDASLNEPSISSSVANTVASDLSDVLLQGISCKLT
KCDKNKRRKMKRRLIISEKTQQRQESKKRKEREKYASNKAFKTEKKSHAKSKYQNNPEFR
QKKINNTRDNVDFQQKRKEYISNRYRENADFRQKKKQIFVSRYRNNPDFREKKKQHFTNR
YRDNAEFRKGKKLSFTAFYKNNIDFRQKKREKERSHIIQRYAHDQAFRLRHKQLMKQRMK
DRYKNNPTYKSMRNMRCAMKIKRKYRQINKPIEESDNSLIKEAISVFRSQIKSGPTYVCT
VCHKASFPNQVKPCKRLNYVRNPDVAAACLTGKYVHVCDDECRDEQQCNVPDERKEEWIC
HTCHNHLKDGVMPTLAVANNLELADIPPELCDLNILERHLIAKCIAFAKIIPLPKGRQRA
IHGNVVCVPSEVQETVEALPRLRSESQVMRVKLKRRLCYRGHQLFQTVTWSKLVQALHIL
KRIHPQYQDIPIRDEAELCDPTLFKEIDMCDKSALCETETELDGEQDVDMLSCDGEQPEQ
QRDDEEQEGEMPNGGFALESCLQPCDVSEEILCFSEGIYSVAPAESNSPVGFFKTPKLEA
MAFPVQFPTGQNTLDEGRRMKVTPSSYFKARLFCVDDRFARDTNYLFFAQFVTEIHLATS
SMTIQLRKGKPMTRDGRKITSGMLQNKREVEKLVRNKDAVRFMQPLRGTPAYWEKTTRDL
FAMIRQLGTPTFFCTFSAAEMRWPEVIEAIKRQQGEEVNFEGLDWSAKCDILRSNPVTTM
RMFDKRVEALFRDVLLSPAQPLGKVVDYFYRVEFQHRGSPHIHCLIWVEGAPVFEEDDDK
TVSDFVSKYITAQLPDQLTQPELYKKVTEVQIHSKKHSRTCFRSPSSGCRFGFPKPPSRK
TMISRPGEGVAPLQLQIAKSKLQPLNLLLNEPETASLGLQQLLSKCNLTLQEYEGCLNII
NKSSAVILKREPKDCWVNGYNAHLLEAWDANIDVSYILNAYSCIMYLTSYITKKESGLSE
YLKTVIENSTKDHVNECDEMREIMQAYSKKREVSAQECVTRACGINMKKCSRGVIFVPTD
DNALKMSRPMSYLENTTLESVNVWMTSLTDKYKSRPETPEFEQMCLADFAATCRIVYGQQ
KKGKDVLPLLNDMGFVQKRKNDKPAIIRFYRCSQEKYPEKFYGTLLKLYIPHRSDLELKR
RHFPTYESFYKSGCVQLPGSDHPEYVRHIVKRNKDKYEKNSEDIENAVEEFEQNRGVIDE
WCNLAPESEVRLECIEELEAREPDHENVQENVPEYTNQANAATEARAIREPPTFDPTVLR
KMYQNLNQKQACVFYAVRDWCVKRVCGLNPEQFFFYVNGGAGTGKSHLIKCIYSEASKIL
CKLPSHSEEVDISNPTVLLTAFTGTAAFNISGSTLHSLLKLPRSLKPPQGLGNQLDEVRS
ELLNAEILIIDEVSMVSKPLFAYVDARLKQIKGSPKPFGGMSVIAVGDFYQLPPVRQSKT
LCVYEPCEIDLWQEHFQTITLTEIMRQKDDVAFAEMLNRIRVKGKSDELSQADRALLSQT
ITEPSLCPPDVLHIFATNKQVDSHNSVTLALLHSNITKIDADDYKKDPRTGRMARQAQPY
KGNRNELPDTLNVAEGARVMLTRNIDVSQGLVNGSFATLVRVITAEQSGVAHVTMLGLKM
DDQTAGRNYRNRAPGGPDDVVYIERAEDLKQKGVVRRQFPVRLAFACTIHKVQGMTRTSA
VVSLKHIFEPGMAYVAISRVTSLSGLHMLDLDESKIYANPEITGALETMRQVNLDDVMPL
LRIKETSSRHDTLTIVHHNTEGLPSHIIDIRSHHELCLADVLCLTETHLQGSFVAQSLHL
EGYNMFKRNRHLSYTNVPQIANRGGGGVAVYVKSHIQVREKQYVHNVTDLEFVALKVEAP
VRALIAAVYRPPDYSVRSFLSNLGSLLDSLEIMDCQPIIVCGDFNENLFSNTGKPILELF
QSRGFAQVITAATTDKNTLLDLIFISQPQRCLHSGVMRTYYSYHNPVYCVMS
Download sequence
Identical sequences G3Q6B8
69293.ENSGACP00000025427 ENSGACP00000025427 ENSGACP00000025427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]