SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000025525 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000025525
Domain Number 1 Region: 161-275
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-34
Family Spermadhesin, CUB domain 0.00025
Further Details:      
 
Domain Number 2 Region: 39-150
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.55e-34
Family Spermadhesin, CUB domain 0.00028
Further Details:      
 
Domain Number 3 Region: 342-466
Classification Level Classification E-value
Superfamily TIMP-like 3.61e-32
Family Netrin-like domain (NTR/C345C module) 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000025525   Gene: ENSGACG00000019312   Transcript: ENSGACT00000025575
Sequence length 466
Comment pep:known_by_projection group:BROADS1:groupVII:4003245:4008614:1 gene:ENSGACG00000019312 transcript:ENSGACT00000025575 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PRSDSMGDRVWTAGLLLILTLGWTEAQSQSNFSRPVFLCGGHLVTDSGIVASEGFPSPYK
ANSKCTWYITVPEGHVVMLSFRLFDMEADPTCRYDYLDVYNGHTRLVQKLGRFCGTFRPG
AIIATSNTMMLEMVSDEGTGGRGFIAAFSAGKPHVEEHQFCGGRLTKAQGSVKTPNWPNS
NYPAGISCSWHISVEPSNVIEVKFVKLDLEPDTYCRYDYVALFNGGERDNSRRIGKFCGD
RSPGTIVTNGNELLVQFVSDLSVTSDGFMAHYSSVPRGSRAPTAGGDFIYGPQTTSMPGR
AVVKPSKPAKPTPKPRPGSKPVPKPPKKPLVKIPLKPPPPLPLNPLCTQACKKTGTLQSS
FCLHDFVITGKVTSLTTGPRGSATVEVSVIKAYKAGRLNMVKSGLLMSVTLASTCKRCPG
LIKGRNYVLMGKVDAQGNGLLSPSSFSLLYQPVHGKALANLTRKPC
Download sequence
Identical sequences G3Q6L5
ENSGACP00000025525 ENSGACP00000025525 69293.ENSGACP00000025525

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]