SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000025531 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000025531
Domain Number 1 Region: 423-552
Classification Level Classification E-value
Superfamily TIMP-like 3.22e-22
Family Netrin-like domain (NTR/C345C module) 0.046
Further Details:      
 
Domain Number 2 Region: 288-340
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000173
Family Laminin-type module 0.022
Further Details:      
 
Domain Number 3 Region: 351-390
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000265
Family Laminin-type module 0.016
Further Details:      
 
Domain Number 4 Region: 232-285
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000204
Family Laminin-type module 0.032
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000025531
Domain Number - Region: 90-182
Classification Level Classification E-value
Superfamily Sialidases 0.00216
Family Sialidases (neuraminidases) 0.054
Further Details:      
 
Domain Number - Region: 24-121
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0978
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000025531   Gene: ENSGACG00000019318   Transcript: ENSGACT00000025581
Sequence length 553
Comment pep:known_by_projection group:BROADS1:groupVII:4039346:4045906:1 gene:ENSGACG00000019318 transcript:ENSGACT00000025581 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TSPHDPCYYVDGRPRHCLSEFINAAYGVSANASHSLHGPDRDSGITTLTDLHNPHNLTCW
TPHGGHDTGHWVLSLALGRRFEITYISLQFCQRGEPSDPISISILKSMDYGRTWRPMQHY
SSDCLGDFGLPSQTVAQTRHQETEPLCSDPRPLQKQRGGMVLAFSALDGRPSSPDFDHSH
TLQDWVTATDIRVVFHRMSKEGDRLNADNTLALFERDTKKLALSDVQVGGRCKCNGHAST
CRRDDTGRAVCVCEHHTAGQDCDVCEDFYCDRPWHRATPTHPNPCVACECNGHSNKCRFS
MEVFQQSGRRSGGVCLKCRHHTAGRHCQYCQNGYTRDQSKLLNHRKDCQACQCHPLGAVG
RWCNQTSGQCLCREGVTGLRCNRCAPGYQQGKSPLRPCIRIQEVAPTPMYQPQYSIAEEC
VSYCQPSQAKVRMNLETYCLKDFVLKVQVKAMERSGPWWQFLHLRPSSARGPASRVRRGP
QSLWVPDRDLGCGCPALHVGRTFLLIGAEEGERGWGPEESRLVADRSTLALQWREHWSPK
LRGFRGQDKRGRC
Download sequence
Identical sequences G3Q6M1
ENSGACP00000025531 69293.ENSGACP00000025531 ENSGACP00000025531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]