SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000025547 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000025547
Domain Number 1 Region: 751-859
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.01e-23
Family Spermadhesin, CUB domain 0.0028
Further Details:      
 
Domain Number 2 Region: 281-408
Classification Level Classification E-value
Superfamily Growth factor receptor domain 7.53e-18
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 3 Region: 4-133
Classification Level Classification E-value
Superfamily Growth factor receptor domain 9.57e-17
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 4 Region: 243-287
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000611
Family EGF-type module 0.016
Further Details:      
 
Domain Number 5 Region: 129-280
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000565
Family Growth factor receptor domain 0.016
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000025547
Domain Number - Region: 622-744
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000118
Family Growth factor receptor domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000025547   Gene: ENSGACG00000019325   Transcript: ENSGACT00000025597
Sequence length 937
Comment pep:known_by_projection group:BROADS1:groupIV:24111028:24187621:-1 gene:ENSGACG00000019325 transcript:ENSGACT00000025597 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DPDECAEGSDDCHIDALCQNTPKSYNCICKPGYKGDGKQCEDMDECENDYNGGCVHECIN
IPGNYRCTCYDGFMLAHDGHNCQDVDECADNNGGCQQVCVNTMGSYECQCTDGFFLSDNQ
HTCIHRSDDGMNCMNKAHGCAHICREAPGKGGVSCECRPGFELAKNQKDCTLTCNYGNGG
CQHTCDDTDTGPVCGCHQKYALHSDSKTCIEKDEAAIESSEFNATSVADVDKRVKRRLLM
ETCAVNNGGCDRTCKDTATGVRCSCPVGFTLQPDGKTCKDIDECQENNGGCDHFCRNTVG
SFECSCQKGHKLLTDERTCQDIDECSFERTCDHICVNYPGSFECLCHKGHILYGLTHCGD
IDECSISNGSCEYGCINTQGGYECVCPPGQKLHWNKKDCIEAVKCLPNGKPALRAQLTCT
KSVGAEVCSLSCPSNALFLADSENSYTLSCGVPVQLGKAPQKRNATTALPTCADTLAPPI
KQKARFKIKDAKCHLRPRNKEKHRESSRQSLQGGQFPCTDDCHVTFVNLKCDSSKKRRRG
RKSPSKEVSHITAEFEMEMKEEEASDLCNVDCVRERMKQKLQSAMRTLRKSINKQQFYIQ
FSGTEYEVAQKPSRVLEGAEACSTGTSPPRRQSGQCPAGHFSADGFHPCQPCQLGSYQTE
PGRVLCFLCGGGLMTKYEGSVSFRDCEAKVHCAPGHYYNSTTHRCIRCPGGTYQSEFGQN
YCITCPGNTTTDFDGATNVSHCKNQLCGGELGEYTGYIESPNYPGDYPSNVDCVWTINPP
HKRRILIVVPEIFLPIEDECGDVLVMRKSALPTSITTYETCQTYERPIAFTSRSRKLWIQ
FKSNEGNSGKGFQVPYVTYDEDYQQLIEDIVRDGRLYASENHQEILKDKKLIKALFDVLA
HPQNYFRYTAQESKEMFPRSFIKLLRSKVTRFLRPYK
Download sequence
Identical sequences G3Q6N7
ENSGACP00000025547

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]