SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000025667 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000025667
Domain Number 1 Region: 82-137
Classification Level Classification E-value
Superfamily RuvA domain 2-like 0.00000000222
Family Tex HhH-containing domain-like 0.096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000025667   Gene: ENSGACG00000019419   Transcript: ENSGACT00000025717
Sequence length 360
Comment pep:known_by_projection group:BROADS1:groupIX:17376838:17379284:1 gene:ENSGACG00000019419 transcript:ENSGACT00000025717 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWVARRLLSSVAQRTGRYAGPPALFRHPRHGCLPDLEPRYLQCTCCWRSRVPVAGFETLN
AAISSTSEPCDEDNRSLDACYTSEQRHAILRLLNTATPSELAGVKLLRGRKSVNIVEYRT
RNGPFPTLESVVNVPLLKHKSAVTVFNSILNPVKKEKKVKIQLAKFIRPEVDRSWLEDAS
NIVSLVCGTNKIAWAQVDRGMTLLDWRQVECPNFLRGTYMASAYLNDVSTNTKRWWAFLS
SVDFYIIEKSSISVQNTVPVPHHFLTSPPLLRRVLNMMRAAVGRHFGLMLGESRTSGAQT
VRRLMTESVTQTLPRLRFPQELLLKHRNSFQMGSRRGGEELCDALLQAVAFYELLSESSS
Download sequence
Identical sequences G3Q707
ENSGACP00000025667 ENSGACP00000025667 69293.ENSGACP00000025667

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]