SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000025769 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000025769
Domain Number 1 Region: 57-309
Classification Level Classification E-value
Superfamily DNase I-like 3.01e-76
Family DNase I-like 0.00000000599
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000025769   Gene: ENSGACG00000019497   Transcript: ENSGACT00000025819
Sequence length 311
Comment pep:known_by_projection group:BROADS1:groupIV:25509908:25512909:1 gene:ENSGACG00000019497 transcript:ENSGACT00000025819 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SMKRGKKAEEAATDGENETGSASAKKTKKAKEPEAPILYEDPPDKMTSKDGRNGNVKITS
WNVDGLRAWVKKNGLDWVREENPDVLCLQETKCAEKSLPADITSMPEYPHKYWAASDEKE
GYSGVAMLCKTEPLKVTYGIGKEEHDKEGRVITAEFPNFYLVTAYVPNSGRGLVRLDYRK
TWDVDFRAYLSELDMQKPLVLCGDLNVAHQEIDLKNPKGNKKSAGFTPEEREGISQLLES
GFTDSFRELYPEQANAYTFWTYMMNSRGKNVGWRLDYFLLSSSLLPGLCDSKIRNKALGS
DHCPITLHIAV
Download sequence
Identical sequences G3Q7A9
ENSGACP00000025769 69293.ENSGACP00000025769 ENSGACP00000025769

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]