SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000026056 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000026056
Domain Number 1 Region: 360-587
Classification Level Classification E-value
Superfamily GFP-like 2.09e-83
Family Domain G2 of nidogen-1 0.000000166
Further Details:      
 
Domain Number 2 Region: 880-1081
Classification Level Classification E-value
Superfamily YWTD domain 1.1e-36
Family YWTD domain 0.000000418
Further Details:      
 
Domain Number 3 Region: 741-844
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 1.22e-19
Family Thyroglobulin type-1 domain 0.001
Further Details:      
 
Domain Number 4 Region: 317-357,596-677
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.57e-19
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 5 Region: 720-765
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000193
Family EGF-type module 0.014
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000026056
Domain Number - Region: 684-729
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00125
Family EGF-like domain of nidogen-1 0.044
Further Details:      
 
Domain Number - Region: 1138-1164
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0141
Family EGF-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000026056   Gene: ENSGACG00000019719   Transcript: ENSGACT00000026107
Sequence length 1172
Comment pep:known_by_projection group:BROADS1:groupIX:18943449:18956285:-1 gene:ENSGACG00000019719 transcript:ENSGACT00000026107 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
INTNGLVSFDGPPKEQEYLGKMPAGFGMIAALLGDLEDSDGQGKVHFRWDSSPEVLSRAA
EYVSRAFPRDEGVEPTAALVVTWENMAARGTTGRGDGLGTKRNTFQLVVASMESSSCAIL
LYPRSGLQFVSTSVGGENKLLEAGFNQGLVAGWFWKDSQGTYFRTTTDEETSVRDLAEKT
NSGQNGVWVYEIGSSPFFHAIAPGTVTGLLEEEEEATTPAVEFEPEFSESETVTPGYTDP
EKAERRYPDPSEPRYPDSEPSQPRYLDPETNEPRYSPVDPTHPDLVQPVPRHSRPQQPQI
VVVDEEEALDVTVFAYNSETCAHNRLKCSAFADCRDYSNGYCCHCRPGFYGNGKDCVAEG
KPQRMNGKVSGRVFVGNSPSAVELSNNDLHSYMVVNDGRASVAISNIPDALGPSMLPLTP
LGGVIGWAFALEQPGHRNGFSLIGGRFSRQAEVTFHPGNERLTITQQFKGIDEHDHLVVD
TELEGRLPAVPLGSSVEINPYQEVYQYDRNLIASSSNRDYTVTSPDGEVQTRSYQLRQSL
TFEGCAHGEASGAAPSTQQLSVDRVFVMFEAHNRLIRYATSNKIGSVHGSDPEQNPCFTG
RHGCDINAACRPAEGLQFSCQCAAGFIGDGRYCHDDDECRSPEICGSNAVCNNQPGSFHC
ECSAGFLFASDGKTCIAAEEKRPADPCQGGSHDCDAPERALCSPAGGAAFACSCLPGFEG
DGRLCRDVDECQQDRCHSAAFCSNTQGSYACQCHPGFHGDGFQCSPASSEREATACERHR
ESARAAAPGFPSTFRPRPAVGHYVPQCDQRGAYESTQCHAAIGQCWCADAAGREIPNTRM
GPGSAHLCIDQAVTPGPGGPTPRPDVHPVPSGTHLLFAQSGIERVPLDGYDMQQEEAKPL
LYLSDRVVIAVAYDCVEEMVYWTDITEPAISRARLSGGDVVPVVTTGLQSPEGLAIDHVA
RLLFWTDSARDTVEVSQLDGGRRRVLHDTDLINPRAIVTNPAYGRLYWSDWNRDGPKIEM
SNMDGTDRSVLVKDDLGLPNGLTFDHEGQQLCWADAGETNLSCYRPADPGIGAIGGPTGR
FPNDAGSLGLHAVYDPPETGSTRGIGGGIPGEYKIFFDFEAINLYGVTATPAQCPQAYNH
CADNGGCSGLCLPRLGGFTCRCPDAGPCEEGS
Download sequence
Identical sequences G3Q842
ENSGACP00000026056 69293.ENSGACP00000026056 ENSGACP00000026056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]