SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000026516 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000026516
Domain Number 1 Region: 317-382
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000949
Family Laminin-type module 0.024
Further Details:      
 
Domain Number 2 Region: 748-798
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000103
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 3 Region: 937-984
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000112
Family Laminin-type module 0.0027
Further Details:      
 
Domain Number 4 Region: 252-319
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000272
Family Laminin-type module 0.054
Further Details:      
 
Domain Number 5 Region: 491-532
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000586
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 6 Region: 1046-1088
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000446
Family Laminin-type module 0.022
Further Details:      
 
Domain Number 7 Region: 439-483
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000024
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 8 Region: 380-430
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000614
Family Laminin-type module 0.02
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000026516
Domain Number - Region: 912-939
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000156
Family Laminin-type module 0.02
Further Details:      
 
Domain Number - Region: 989-1043
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00024
Family Laminin-type module 0.0072
Further Details:      
 
Domain Number - Region: 1094-1141
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000243
Family Laminin-type module 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000026516   Gene: ENSGACG00000020070   Transcript: ENSGACT00000026567
Sequence length 1748
Comment pep:known_by_projection group:BROADS1:groupIV:32332916:32346009:-1 gene:ENSGACG00000020070 transcript:ENSGACT00000026567 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QLPEFPDVCTEGSCYPATGDLLIGRAHKLSVSSTCGAERPERFCIVGHLEEDLKFKILCQ
RGQRTENTPFDSSVEPVTFHFRVLGPNRCVITTQKRTGVENVTIQLDLEAEFHFTHLIMT
FKTFRPAAMVIERSMDFGTTWQVYRYFAHDCEASFPGVPSGPMAKVNEIICDSRYSDIEP
STEGEVIFRVLDPVFEIEDPYSLKIQNMLKITNLRVKFLKLHTLGDNLLDYREEVTEKYY
YALYDMVVRGNCFCYGHASECAPIDHGTPAAIEGMVHGRCVCNHNTEGLNCERCQDFYQE
LPWRPAEGRNSHACKRCECNRHAASCHFDPAVYATTGGASGGVCDDCRHNTAGRQCEQCA
PFYYKHPNRDLRDPNVCQPCDCDPAGSLQGGLCDPRTDVAAGLISGQCRCKANVEGERCD
HCRQGHHGLGAEPHGCLPCTCNPLGTLPGGNPCDPDAGSCFCKRLVGGHNCDACLPQHWG
LSNDMDGCRPCDCDHGGAVHDDCDPRSGQCACREHMHGRRCDRVQSGFYSVSLDHYTYEA
EDAAHGPGVTVVPRPRPLDRSPTWTGPGFVNVPEGAYLEFTVDNVPESMDYDVLIRYEPQ
LPEQWEQVDVRVQRPASTPQEHAPFCGGREDQDDQSVSLPPGSRHVSLGRPVCLERGLNY
TIRLTLPLYSSAGDVQSPYTLIDSLVLIPSVRELNMFHGLDGDEAWDTFQRYRCLESSQS
VIKSPLTDICNDYIFSVSALLHKGAVECRCDPQGSLSAVCEASGGQCRCRPNVAGRNCDR
CAPATFLFGPTGCRPCGCDPLGSVGAFCHEATGQCCSHCLPGRNQRFCCLFLAAALEMNS
PQTRMHCKYCNKHCYTICIVVQKQYLAGKDCVSRICGALVQMLISSRLHVKPEQHLRPPL
TLKTPDSTPPPPGARCDECAPGYFGNPQVPGGRCLPCQCNSNIDMHDPGSCDARTGACLK
CLHHTEGYGCQQCRQGYHGDAAAQTCWKCTCDSAGTSPRACSSPGECQCDRRSGQCPCLP
NVVGQNCDACAADTWDMAGGAGCRRCDCDPVHSFGSSCDEVTGQCSCRPGFGGKTCRECR
ELFWGDPQVKCHACDCDSRGISSGQCHRATGACTCAAGVSGPRCDQCARGHRGDFPACEP
CHRCFAAWDATVGELTNQTRRLEARVTRLRASRVTAPYKDLFRSLERNADAVRGIVERKP
AAELEQIQELMQQITGVMSYLNGKLNTTEETASLLRRDANATDANLGALSDAAEQLQRTV
RELQQRVSDIKNANIQGAADTIAEARAQSVAAERSANTSTSGPGSWVEQSAALRKAAEGK
LSGARKEFDRRNQRNSEKLDKLSAALETLVLSPLSEATCGGAAEGDGCSGSPCGGLGCGG
EGGAPRCGGEGCGGLVAASHAALTSARDRDRQVVAAGHEVDELSRLVWEANNRANEAKVS
ALGALVGSNRSRERVEQSNQQLRSLIMEIRDLLSDEKANVSVIEAVADEVLALKMPTSTQ
ELRELTKEIREKVESLTSVEEILSQSAEDIGAAELLLRRAGSASKEASNTKEAADKMQAV
LDETERAQSVATDALQLAQNNTNATRELLSSVESETAASELKLGNTTGRLLQLDREVGLL
RQNNLEVNRRVETANRTTDRARLDAAEAQQEFDEEVKGRLVTVEDLVEDKGESALQGRTT
AERLQKEAKELLAQSVSKLQRLEELERSYEANQLLLEAKAAELLELEVQARLALEAFSHK
VMLYSTCA
Download sequence
Identical sequences G3Q9F1
ENSGACP00000026516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]