SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000026821 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000026821
Domain Number 1 Region: 162-275
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.02e-34
Family Spermadhesin, CUB domain 0.00024
Further Details:      
 
Domain Number 2 Region: 356-478
Classification Level Classification E-value
Superfamily TIMP-like 4.87e-33
Family Netrin-like domain (NTR/C345C module) 0.00048
Further Details:      
 
Domain Number 3 Region: 40-150
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-31
Family Spermadhesin, CUB domain 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000026821   Gene: ENSGACG00000020298   Transcript: ENSGACT00000026873
Sequence length 478
Comment pep:known_by_projection group:BROADS1:groupVII:15840644:15844216:1 gene:ENSGACG00000020298 transcript:ENSGACT00000026873 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RFTCIMMHADCIWGFSLFLSLTLGWTKAQETNYSRPVFRCGGDLVTDSGFVGSEGFPRFY
KPNSKCTWRITVPEENVVMLSFRAFDLETDPRCRYDYLDVYNGQSNQMQKLNRLCGTRRP
GSLISTTNTITLEMVSDEATQGKGFLAYFSGAKPYVDDQQFCGSKMTKAQGEIKTPNWPD
NKYPASTSCSWLVIVDPGMVIQVKFDKFVLETDTYCRFDYVAFFNGGADDTSLIGKYCGD
QAPQPITSSGNVLIVQFVSDSSVTSDGFLAHYTSVPGAPQILTFNSAAGTGSIPSKPAAL
PAATIKPPVPTAKYVPPEPTRKPKPVKPTRGRGQGTTGQDRRPPVTTPNGKKPVPQNSVC
AKACKRDGKIQSSFCASEFVITGKVTSLARQQGTFRIGITLIRVYKAGGLTMTPVGETVS
VKLVSQCRNCPFLSKGADYIIMGQVDEEGRGTLKPGAFTAPYKAQHERLLMNVSQQPC
Download sequence
Identical sequences G3QAA5
ENSGACP00000026821

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]