SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000026829 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000026829
Domain Number 1 Region: 363-470
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.62e-22
Family Spermadhesin, CUB domain 0.0023
Further Details:      
 
Domain Number 2 Region: 179-290
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.53e-22
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 3 Region: 476-541
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000102
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 4 Region: 536-599
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000528
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 5 Region: 298-362
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000256
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 6 Region: 120-184
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000473
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 7 Region: 11-121
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000196
Family Spermadhesin, CUB domain 0.0095
Further Details:      
 
Domain Number 8 Region: 604-662
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000189
Family Complement control module/SCR domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000026829   Gene: ENSGACG00000020306   Transcript: ENSGACT00000026881
Sequence length 758
Comment pep:known_by_projection group:BROADS1:groupVII:16259602:16292120:1 gene:ENSGACG00000020306 transcript:ENSGACT00000026881 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PHNIKACLPREPCSLNFTDPEGNIKILQQLDSGTECNYLVTVYLGYGIEVQVLNVSALEG
EQVTVEDTGGQEPFILANESVLMRGLVLRSWSNQISIRFRSDQPNNYRFLLLHYQAFVLS
CAFPKEPAGGEVSVTHLHPGGGAYFRCFTGYKLQGAKMLTCRNATTPYWSGKEPRCVASC
GGMIKNATYGRIVSPGFPGNYSNNLTCHWVLEAPEGHRLHIHFEKVALAEDDDRLLIKNG
NNIDSPPVYDSYEVEYLPNEGVLSTERYLFVEFTTDGTLTSTGAAIRYEAAAFAKGMCYE
PFVKYGNFSGGDSNYNVGAVVEFSCDPGYTLEQGSVVIECVDSQNPQWNETEPACRAVCS
GEITDSAGVVLSPNWPEAYDKGQDCIWGIHVEEDKRIMLDIQVLHVGKNDLLTFYDGDDL
TANILGQYSGTRPHFKLYTSMADVTIQFQSDPATNIFGYNNGFVVHFFEVPRNDTCSELP
EITNGWKSTSHPDLVHGTVITYQCYPGFELVGSEILMCQWDLTWSADVPKCQEVMTCQDP
GNVEHSRKVIAGNRFTVGSTVHFVCNKGYILSGSSLLTCYNRDSATPKWNERLPKCAPEK
YEPCRNPGAASTSVQSSEKAFYQAGEVLSFSCHSGYELQGDANIYCIPGHPSQWNSTPPA
CRVASTTEYVNERRLDVVNMDYNMEGTNITLAVLIPTAIILVVVLGIYVYFAKLQGKTIR
MPSSLPPYDNMTEESAFDNPTYESGYSSSTSFMGIKFV
Download sequence
Identical sequences G3QAB3
ENSGACP00000026829 ENSGACP00000026829 69293.ENSGACP00000026829

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]