SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000027041 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000027041
Domain Number 1 Region: 144-181,291-542
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.38e-85
Family Eukaryotic proteases 0.0000396
Further Details:      
 
Domain Number 2 Region: 47-110
Classification Level Classification E-value
Superfamily GLA-domain 5.49e-22
Family GLA-domain 0.00035
Further Details:      
 
Domain Number 3 Region: 100-132
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000807
Family EGF-type module 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000027041   Gene: ENSGACG00000020449   Transcript: ENSGACT00000027093
Sequence length 547
Comment pep:known_by_projection group:BROADS1:groupVII:18693247:18697244:-1 gene:ENSGACG00000020449 transcript:ENSGACT00000027093 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARLCQLAFTAGLLLELYGLAAEYLLGTVFVSQQTADAVLRRLRRYNSKVFEELQPGNLE
RECIEEACTMEEAREVFEDDDKTTAFWARYKVDGDQCQPPPCQNGGECEDGINTYTCYCN
PNFNGKNCEIELKKQCSLNNGGCSHFCLMSADVPVCRCAAGYTLGLDKRSCEPSEQFSCG
RVDITSLAPRSSRNITEHSSEGKHNSSYNLEDDYDIMQFYDDYSIHANDSGPSNVSAASA
AKTRSVRSDRSSSVSPDEAVMSSGEARSATEVEKKQPPSWAFFPTLPTITAQDNTDQRIV
GGNDAIPGEIPWQVALMSRSDTLQREGVFCGGSLISELWVITAAHCLVPTNPNLEDFFVR
VGEHDVSQAEGSEQDHEVAEKHMHHLYDTAKSAYDNDIALLKLAKPVVLSNRRRPICLGL
KDFTENLSRESSTSLVSGWGNLRTTGSQPNKLQKLEVPYVDRTVCKQSSEKPITSGMFCA
GFENEVKDSCKGDSGGPHATNYKGTWFLTGIVSWGEECAKAGKYGVYTRVARFIAWIRRT
TGLRIIN
Download sequence
Identical sequences G3QAX5
69293.ENSGACP00000027041 ENSGACP00000027041 ENSGACP00000027041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]