SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000027122 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000027122
Domain Number 1 Region: 334-453,504-742
Classification Level Classification E-value
Superfamily Tex N-terminal region-like 4.58e-57
Family Tex N-terminal region-like 0.012
Further Details:      
 
Domain Number 2 Region: 764-918
Classification Level Classification E-value
Superfamily Ribonuclease H-like 9.1e-26
Family Tex RuvX-like domain-like 0.01
Further Details:      
 
Domain Number 3 Region: 933-1025
Classification Level Classification E-value
Superfamily RuvA domain 2-like 0.000000000245
Family Tex HhH-containing domain-like 0.01
Further Details:      
 
Domain Number 4 Region: 1312-1404
Classification Level Classification E-value
Superfamily SH2 domain 0.000000000402
Family SH2 domain 0.0029
Further Details:      
 
Domain Number 5 Region: 1214-1269
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000433
Family Cold shock DNA-binding domain-like 0.0098
Further Details:      
 
Domain Number 6 Region: 1038-1125
Classification Level Classification E-value
Superfamily RuvA domain 2-like 0.0000185
Family Tex HhH-containing domain-like 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000027122   Gene: ENSGACG00000020513   Transcript: ENSGACT00000027174
Sequence length 1720
Comment pep:known_by_projection group:BROADS1:groupVII:19379916:19392471:1 gene:ENSGACG00000020513 transcript:ENSGACT00000027174 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDFIESEAEESEEEFDEKDLKPKKTQRFLEEDDEEEEENTEDQDERGNLRGLIDDGEEE
EEEGDRPRSASAAGSDSEEEVRHRRKKRNYDDYLDDDDLDLIEENLGVKVKRRKKKYDRV
KTLDDDEEDDDQKDMIADEIFHGDADGELEEGEAVDEPLHHADDDEEGEDEESDIDDFIV
DDDGQPITKKRGKKFSGYTDAALQEAQEIFGGDFDFADFDADAYDQGEEEEEDQDEEGWD
RPKKQTKRRQGRKSIFEIYEPSELESSHMTDQDNEIRSTDMPERFQLRSIPVKPAEDDEL
EEEAEWIFRHGFSTLTISMQESTDYLDRGTTTNFSRKGPSTIAKIKEALNFMRNQQFEVP
FIAFYRKEYVEPELNINDLWKVWQWDEKWTQLKTRKQNLTRLFRKMQSYQYEQISADPDK
PLADGIRPLDTADMERLKDVQTLEELSDVYNHFLLYYGRDIPKMQNTAKSSKKRLKKIKE
VTEDEEELEIEEEEEEQKGPDLKLASRRDMYSICQSVGLDGLAKKFGLTPEQFGENLRDS
YQRHETEQFPAEPVELAKDYVCSQFSTSEAVLEGTRYMVAMQIAREPLVRHVLRQTFQER
AKINIKPTKKGKKEVDEAHFAYSFKYLKNKAVKELNGDQFLKMCLAEDEGLLSIDICIDL
VGVKGYAGDQTYFDEIKQFYYRDEFSHQVQEWNRQRTLAIERALTQFLYPQMAKELKSKL
ITEAKESIIRSCCRRLYNWLKVAPYRPDQQVEEDDDLMDESQGKGIRVLGVAYAPSRDTP
VFCALINGEGEVVDFLRLPYFMKRRNAFKEDEREKKAHDIETLKKFLSGKKPHVVAVAGE
SRDAQMIMEDIKRAVSELEQESSLPAVGVELVDNELATLYMNSKRSEIDFRDYPPLLRQA
VSIARKIQDPLMEYAQVCSTDDDILCLKLHPLQEQVVKEDLLCALHCEFINRVNEVGVDV
NKAIAHPHTQSLVQFVCGLGPRKGSQLLKILKQNNTRLENRTQLVTMCHMGPKVFINCAG
FIKIDTASLGDSTDSYIEVLDGSRVHPETYEWARKMAVDALEYDESAEDANPAGALEEIL
ENPERLKDLDLDAFAEELERQGYGNKGITLYDIRAELSCRYKDLRVVYRVPNTEEVFNLL
TKETPETFYIGKLITSIVTGIAHRRPQGESYDQAIRNDSTGLWQCPFCQQDNFPELSEVW
NHFDSGSCPGQAIGVRSRLDNGVQGFIPTKFLSDKTVKHPEERVKVGMTVHCRIMKIDIE
KFSVDLTCRTSDLMDKANEWKLPKDSYYDFDTETEDQKHEEELKKKQQRTPYIKRVIAHP
NFHNISFNQAEKMMESLDQGDLIIRPSSKGENHLTVTWKVAEGIYQHVDVREEGKENAFS
LGHTLWINNEEFEDLDEITARYIQPMASFARDLLGHKYFQDGLWGIKEKMEELLVKTKRE
KPTFIPYFLSACKEMPGKFILGYQPRGKPRVEYVTITPDGFRYRSQIFPTVNGLFRWFKD
HYQEPVPGVTPSNSSRTRTPASLNATPANINIADLTRAVNALPRNMTSQMFSAIAAVTGQ
GQNPNTTPAQWGSSQYGYSGSTGGGGGGGGGSSSAYHVFATPQQPMATPMMTPSYSYTTP
SQQALGTPQYASSTPQSSHAHGHPHGSHVTPQQQPQPAGGSSASAVDWGKMAEQWLKEKE
AEGRKKTPRMTPRPSPSPMIESTPMSIAGDATPLLDEMDR
Download sequence
Identical sequences G3QB56
ENSGACP00000027123 ENSGACP00000027122 69293.ENSGACP00000027122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]