SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000027123 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000027123
Domain Number 1 Region: 2-233
Classification Level Classification E-value
Superfamily Tex N-terminal region-like 1.06e-36
Family Tex N-terminal region-like 0.012
Further Details:      
 
Domain Number 2 Region: 255-409
Classification Level Classification E-value
Superfamily Ribonuclease H-like 3.72e-26
Family Tex RuvX-like domain-like 0.01
Further Details:      
 
Domain Number 3 Region: 424-516
Classification Level Classification E-value
Superfamily RuvA domain 2-like 0.000000000116
Family Tex HhH-containing domain-like 0.01
Further Details:      
 
Domain Number 4 Region: 756-848
Classification Level Classification E-value
Superfamily SH2 domain 0.000000000187
Family SH2 domain 0.0029
Further Details:      
 
Domain Number 5 Region: 660-715
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000194
Family Cold shock DNA-binding domain-like 0.0084
Further Details:      
 
Domain Number 6 Region: 529-616
Classification Level Classification E-value
Superfamily RuvA domain 2-like 0.00000867
Family Tex HhH-containing domain-like 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000027123   Gene: ENSGACG00000020513   Transcript: ENSGACT00000027175
Sequence length 949
Comment pep:known_by_projection group:BROADS1:groupVII:19383873:19390705:1 gene:ENSGACG00000020513 transcript:ENSGACT00000027175 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYSICQSVGLDGLAKKFGLTPEQFGENLRDSYQRHETEQFPAEPVELAKDYVCSQFSTSE
AVLEGTRYMVAMQIAREPLVRHVLRQTFQERAKINIKPTKKGKKEVDEAHFAYSFKYLKN
KAVKELNGDQFLKMCLAEDEGLLSIDICIDLVGVKGYAGDQTYFDEIKQFYYRDEFSHQV
QEWNRQRTLAIERALTQFLYPQMAKELKSKLITEAKESIIRSCCRRLYNWLKVAPYRPDQ
QVEEDDDLMDESQGKGIRVLGVAYAPSRDTPVFCALINGEGEVVDFLRLPYFMKRRNAFK
EDEREKKAHDIETLKKFLSGKKPHVVAVAGESRDAQMIMEDIKRAVSELEQESSLPAVGV
ELVDNELATLYMNSKRSEIDFRDYPPLLRQAVSIARKIQDPLMEYAQVCSTDDDILCLKL
HPLQEQVVKEDLLCALHCEFINRVNEVGVDVNKAIAHPHTQSLVQFVCGLGPRKGSQLLK
ILKQNNTRLENRTQLVTMCHMGPKVFINCAGFIKIDTASLGDSTDSYIEVLDGSRVHPET
YEWARKMAVDALEYDESAEDANPAGALEEILENPERLKDLDLDAFAEELERQGYGNKGIT
LYDIRAELSCRYKDLRVVYRVPNTEEVFNLLTKETPETFYIGNIQHTLNGSCPGQAIGVR
SRLDNGVQGFIPTKFLSDKTVKHPEERVKVGMTVHCRIMKIDIEKFSVDLTCRTSDLMDK
ANEWKLPKDSYYDFDTETEDQKHEEELKKKQQRTPYIKRVIAHPNFHNISFNQAEKMMES
LDQGDLIIRPSSKGENHLTVTWKVAEGIYQHVDVREEGKENAFSLGHTLWINNEEFEDLD
EITARYIQPMASFARDLLGHKYFQDGLWGIKEKMEELLVKTKREKPTFIPYFLSACKEMP
GKFILGYQPRGKPRVEYVTITPDGFRYRSQIFPTVNGLFRWFKDHYQEP
Download sequence
Identical sequences G3QB57
ENSGACP00000027123

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]