SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000027169 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000027169
Domain Number 1 Region: 118-394
Classification Level Classification E-value
Superfamily L domain-like 3.4e-42
Family Ngr ectodomain-like 0.0052
Further Details:      
 
Domain Number 2 Region: 418-720
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 1.28e-37
Family Rhodopsin-like 0.00062
Further Details:      
 
Domain Number 3 Region: 44-82
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000301
Family LDL receptor-like module 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000027169   Gene: ENSGACG00000020550   Transcript: ENSGACT00000027221
Sequence length 737
Comment pep:known_by_projection group:BROADS1:groupVII:19898579:19924020:1 gene:ENSGACG00000020550 transcript:ENSGACT00000027221 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLVPLLFQHLKLCFLIPQKFLTTHINVANCISPSALLASRLEVHAGCPLGQFPCGNISEC
LPQALQCNGHRDCPNGADERRCGDNIGWADLIGQTLQDANDVDNYFRDECFLQEYPESCD
CIQTDVECVAVNLQAVPLLSTNVTSLSLRSNEIRVLSDCVFSEYSYLEKLFLQNNSLQFI
SKHAFSGLHSLKKLFLSENLISSLSPGVFKNLHQLVWLWILDHNPLSNLSQDAFIGLQSL
MYLSMVGTALQQLPHQSFCQHMPALDWLDLEGNQIQTLNYSILKTCSKLEVLLLMDNRIR
SIPENTFQSLWKLAELNLSSNRIRELPKNTFKSLSKSLLKLNISHNPLLRIHHSHFNHLS
HLQSLALEGIEISDIQTKMFLPMKNLSHIYFETFQYCSYAPHVRSCKPNTDGISSFEDLL
ANMVLRVSVWVMAFITCFGNLFVIGMRSLIRAENNLHAACIKVLCCADCLMGVYLFFVGV
FDIKFRGQYNRNALLWMESIECRTIGFLAMLSSEVSVLLLTYLTLEKFLVIVFPFSNLRP
SKLQTVVVLASIWLLGFIIAAVPLMNEDLFGNYYGRNGVCFPLHSDRQEKPTAKGYSTGI
FLGLNLVAFLVIAVSYSSMFYSIYKTGINATDLRSRLHRDVAVANRFFFIVFSDALCWIP
IFLVKTLSLLDVEIPGTISSWMVVFILPINSALNPILYTLTTSFFREQVEVLLCRWQRRH
ILKKDRKSLTSSTIFME
Download sequence
Identical sequences G3QBA3
ENSGACP00000027169 69293.ENSGACP00000027169 ENSGACP00000027169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]