SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000027206 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000027206
Domain Number 1 Region: 525-807,841-888
Classification Level Classification E-value
Superfamily DNase I-like 3.48e-56
Family Inositol polyphosphate 5-phosphatase (IPP5) 0.0000272
Further Details:      
 
Domain Number 2 Region: 879-968
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000356
Family Canonical RBD 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000027206   Gene: ENSGACG00000020575   Transcript: ENSGACT00000027258
Sequence length 1307
Comment pep:known_by_projection group:BROADS1:groupVII:20539803:20556888:1 gene:ENSGACG00000020575 transcript:ENSGACT00000027258 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFSKGYRIYHKLDPPPYSVIVETRSREECLMFESGAVAVLSAAEKEAIKNSYAKILDAY
GVLGVLRLNLGDSMLHSLVVVTGCSSVGKVQDSEVFRVTQTDFISLNNDPGDEDRIAEVR
KVLNSGHFYFAWSATGVSMDLSLNAHRRILEDTTDNRFFWNQSLHLHLKHYGVNCDDWLL
RLMCGGVEVRTIYAGHKQAKACIFSRLSSERAGTRFNVRGTNDDGQVANFVETEQVIFLD
DKVSSFIQIRGSIPLFWEQPGIQVGSHRVKLSRGFEANAPAFERHFTALRRLYGKQVIIN
LLGGKEGEHMLSKAFQSHLKASEHTAAVKMVNFDYHQNVKGGKADKLHSVLKPYLTKFID
ECGFFYYSGETGIVRTQGGTLRTNCLDCLDRTNSVQAFFALEMLPKQLEEMSLTEKPQLV
ARFQEVFRTMWSANGDSVSKIYAGTGALDGKAKAGKLKDGARSVTRTIQNNFFDSSKQEA
IDILRLGSTLNSDLADKARALLTTSSLYVTEPILQSASPRVLLGMCQNHHKYTRPKQIRV
CVGTWNVNGGKQFRSIAFRNQTLNDWLLDAPKKAGHPEFQDSKANPIDIFAIGFEEMVEL
NAGNIVSASTTNQKLWAAELQKNIPRDHKYVLLAFRAAGGCLVVFIRSQHAPFIRKTRRP
QATTEVEASGRSSITPASAFSSFLFICRPRHTVTERNDDYSEITRRLTFPMGRLLYSHDY
VFWCGDFNYRISMPNEEVKELIKQQNWDALTAGDQLLDQKNAGLVFRGFIEGKLDFAPTY
KYDLFSEDYDTSEKCRTPAWTDRILWKRRKWNFNQTAEAMNVVGAASTSGETDDDPDNPW
SAGTLKYYGRAELKTSDHRPVVSIIDVDILEVDPEARHQVYKEVIALQGPPDGTILVSLC
SSGPDDYFDDALIDELLDKFAQFGEVILIRFVEEKMWVTFLEGYSALAALSLSASTVLGK
MLDIRLKSPGWIKSLEEEMSVERICGSIPTSASSTLLAEDTDMGDDDYDMEGDVEDEVEE
ILPQHLQPGAGSGPGSSPLPSPRGSPCPSPTHGEPVAPGRSGRGGQPSRPSQGPPVDFQP
GPPTSLEPKRPPPPRPHAPPARPAPPQRPPPPSARGQVAVGAPGPGGAPRPNIPPRAGVI
SVPPQSRPQPPSHPGAPRPIPEVHPGAPRPIPDTHPGAPRPVATGQVKPTDLPLGPPSSG
PPPAEPAAARPQAPSPMQAPMQPQKAAPVPSAMQPQHAGPTVQLPPPMQPTYSQPQQAPK
AGPLAAATAGSPQGLSSPKAPPRSRSSHALPPDAAKSETAPAMQVCA
Download sequence
Identical sequences G3QBE0
ENSGACP00000027206 69293.ENSGACP00000027206 ENSGACP00000027206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]