SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000027230 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000027230
Domain Number 1 Region: 3362-3466
Classification Level Classification E-value
Superfamily Cadherin-like 3.01e-31
Family Cadherin 0.001
Further Details:      
 
Domain Number 2 Region: 3257-3362
Classification Level Classification E-value
Superfamily Cadherin-like 2e-28
Family Cadherin 0.00063
Further Details:      
 
Domain Number 3 Region: 923-1036
Classification Level Classification E-value
Superfamily Cadherin-like 7.42e-27
Family Cadherin 0.0015
Further Details:      
 
Domain Number 4 Region: 2292-2399
Classification Level Classification E-value
Superfamily Cadherin-like 3e-26
Family Cadherin 0.0012
Further Details:      
 
Domain Number 5 Region: 2815-2941
Classification Level Classification E-value
Superfamily Cadherin-like 1.11e-25
Family Cadherin 0.0011
Further Details:      
 
Domain Number 6 Region: 1142-1248
Classification Level Classification E-value
Superfamily Cadherin-like 1.31e-25
Family Cadherin 0.0017
Further Details:      
 
Domain Number 7 Region: 3152-3264
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-25
Family Cadherin 0.0017
Further Details:      
 
Domain Number 8 Region: 3863-4067
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.12e-25
Family Laminin G-like module 0.016
Further Details:      
 
Domain Number 9 Region: 2497-2614
Classification Level Classification E-value
Superfamily Cadherin-like 6.85e-25
Family Cadherin 0.0011
Further Details:      
 
Domain Number 10 Region: 460-578
Classification Level Classification E-value
Superfamily Cadherin-like 7.46e-25
Family Cadherin 0.0018
Further Details:      
 
Domain Number 11 Region: 1555-1661
Classification Level Classification E-value
Superfamily Cadherin-like 1.1e-24
Family Cadherin 0.0014
Further Details:      
 
Domain Number 12 Region: 1027-1148
Classification Level Classification E-value
Superfamily Cadherin-like 2.62e-24
Family Cadherin 0.001
Further Details:      
 
Domain Number 13 Region: 3050-3158
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-23
Family Cadherin 0.00097
Further Details:      
 
Domain Number 14 Region: 1455-1559
Classification Level Classification E-value
Superfamily Cadherin-like 8.99e-23
Family Cadherin 0.001
Further Details:      
 
Domain Number 15 Region: 147-267
Classification Level Classification E-value
Superfamily Cadherin-like 2.88e-22
Family Cadherin 0.0021
Further Details:      
 
Domain Number 16 Region: 823-928
Classification Level Classification E-value
Superfamily Cadherin-like 4.71e-22
Family Cadherin 0.00067
Further Details:      
 
Domain Number 17 Region: 719-830
Classification Level Classification E-value
Superfamily Cadherin-like 8.99e-22
Family Cadherin 0.0019
Further Details:      
 
Domain Number 18 Region: 2088-2190
Classification Level Classification E-value
Superfamily Cadherin-like 3.57e-21
Family Cadherin 0.0011
Further Details:      
 
Domain Number 19 Region: 1764-1883
Classification Level Classification E-value
Superfamily Cadherin-like 2.86e-20
Family Cadherin 0.0014
Further Details:      
 
Domain Number 20 Region: 2607-2712
Classification Level Classification E-value
Superfamily Cadherin-like 6.41e-20
Family Cadherin 0.004
Further Details:      
 
Domain Number 21 Region: 1669-1770
Classification Level Classification E-value
Superfamily Cadherin-like 7e-20
Family Cadherin 0.0021
Further Details:      
 
Domain Number 22 Region: 2191-2298
Classification Level Classification E-value
Superfamily Cadherin-like 2.09e-19
Family Cadherin 0.0022
Further Details:      
 
Domain Number 23 Region: 3462-3582
Classification Level Classification E-value
Superfamily Cadherin-like 9.14e-19
Family Cadherin 0.0027
Further Details:      
 
Domain Number 24 Region: 1250-1356
Classification Level Classification E-value
Superfamily Cadherin-like 1.26e-17
Family Cadherin 0.0038
Further Details:      
 
Domain Number 25 Region: 2401-2500
Classification Level Classification E-value
Superfamily Cadherin-like 7e-17
Family Cadherin 0.0017
Further Details:      
 
Domain Number 26 Region: 2944-3048
Classification Level Classification E-value
Superfamily Cadherin-like 7.85e-17
Family Cadherin 0.0029
Further Details:      
 
Domain Number 27 Region: 571-671
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000183
Family Cadherin 0.0027
Further Details:      
 
Domain Number 28 Region: 1988-2095
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000814
Family Cadherin 0.0035
Further Details:      
 
Domain Number 29 Region: 1363-1461
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000366
Family Cadherin 0.01
Further Details:      
 
Domain Number 30 Region: 2718-2827
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000004
Family Cadherin 0.0045
Further Details:      
 
Domain Number 31 Region: 43-159
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000798
Family Cadherin 0.012
Further Details:      
 
Domain Number 32 Region: 1877-1983
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000357
Family Cadherin 0.002
Further Details:      
 
Domain Number 33 Region: 375-444
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000757
Family Cadherin 0.0098
Further Details:      
 
Domain Number 34 Region: 4106-4148
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000092
Family EGF-type module 0.015
Further Details:      
 
Domain Number 35 Region: 4068-4105
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000434
Family EGF-type module 0.027
Further Details:      
 
Domain Number 36 Region: 4137-4180
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000154
Family EGF-type module 0.0065
Further Details:      
 
Domain Number 37 Region: 3567-3667
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000183
Family Cadherin 0.014
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000027230
Domain Number - Region: 260-361
Classification Level Classification E-value
Superfamily Cadherin-like 0.000628
Family Cadherin 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000027230   Gene: ENSGACG00000020589   Transcript: ENSGACT00000027282
Sequence length 4536
Comment pep:known_by_projection group:BROADS1:groupVII:20749176:20805555:1 gene:ENSGACG00000020589 transcript:ENSGACT00000027282 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FGPYIFFCKNTEPWFCIYFFFLSFFSTHAQFLTEPRAGQGLLLFTQPTYNASIFENSAAR
TYSSSDVKMGIFLGPPRSLDIKYSISSGDSEGIFQAEEFVIGDFCFLRIRTNGGSGATLN
REVQDNYTVTVKASSHGGLEALATVYIKVLDTNDLRPLFSPTSYSFIVSESAPLGASIGR
VTATDADVGSNGEFYYFFKNRVELFAVHPTSGVLTLTGRPRMDKQDRFELEVQVVDRGMK
LYGNNGISSTARLVLTIERVNQFAPVLKAVAVVPSWADKDPVYAIMTVKDKDEGVSGDIE
WVSIIEGDPLEQFVIDRSPVGNEYRVKTSELFDWDTFPYGCNLTFQAKDRGIPPKFSNTQ
LVQLLVSKPEPVLATFERDVYVVQLSEIAPPGTIVEVVKISPAPLGVNYSFSSPSDQMYF
DINPLTGVIMTKRQLTGISQDFMEMEVVDIIGQQQARVQITLVDANDNSPAFNKPFYDIA
INESLPIGTVALVVSAVDADKGENGYVTHTIRGEQDLPFTIDQDTGEVRITTDLDFESSV
DIYTFAVRASDWGSPYRRESEVNVTIRLTNINDNQPLFERVSCKGMISRDFPVSQTIVTL
SAVDMDELGVVTYKILSGNELDYFNLNAESGALSLKRSFGLASLKSGTFNLKIMATDGEI
SSDPTFVNVSVVRGRMPPMGFNCKETRVAQLLAEKMVSKVSAMARPRRDEIYTDLYSINQ
RTPQFEALPTSILVKEDLAVGASVFQVRARDGDIGFNGRVLFSISEGNKENCFNISMQKG
LITLLNPLDRERVDRYFLNITIYDQGVPQMCNWRLLTVIIDDVNDNDPQFHKNSFSALVA
ENSAIGVEVITMTAIDRDKGQNGQLSYVMLTKVPQFGIDSETGSVFVSSHLDRETTPMFT
LKIEVRDKAERGSRRSSVTTLSIIVEDVNDCGPAFIPSSYSARVLEDLPPGAVITWVQAQ
DLDLGPSGQVRYSLGNDFNGTFEINAVSGVLRIRKELDFEKQQLFNLTVAAEDRGVPSLK
SQTFVEVEVVDVNENLYAPYFPDFALRGSVKENSRAGTSVLTVNAKDDDKGRDGVLRYSI
RGGSGLGTFTIDEDTVSTGVIYTAGILDCETKGSYWLTVSATDRGVTPLSASIEVFLQVE
DVNDNAPLTSDPIYHPVIMENSPKDVSVIRIQAQDPDLTATPSRLSYRITAGNPQNFFSI
NPKTGLITTTARKLDREQQAEHFLEVTVIDGPVTTRQSTVWVIVHIEDENDNPPTFPEVT
YRISLTERDRNKRGEQVYRVFAYDRDLGDNGNITYSIVDGNADEKFGIDPRTAMVSSKKM
VTAGSYDILTIKAEDSGDPPLWSTVKLHVEWIRKPVPSPVPLVFTQKFYNFSILETAAVA
QPVGVVAVSQSSALVWFNIIGSFDMQFDLQVGVGTLVVAKPLDAEVQSVYNMTVQVTDGT
NFATTQVFIRILDCNDNPPVFSQPAYDVSVSEDAPLDMELLRVRATDVDERARLTFSIYG
SVDPVSMRLFRVNPGTGVVYTSDSLDYEARTQHILTIMVKDQEFPFNRDLARILVAVEDS
NDNIPYFPSTVYDAVAYESSPIGTSVLKVTALDKDNGINGQLTYSMEAGNTGGVFGIDNA
TGLIFIAKDLDIISVGFYTLTVRVTDSGFPPLMATASARISLILSDFSQPKFSLNEYQAE
IMENSTVGTHVTTVSALSRSALIYDISRGNDDNSFAINHHTGVISTRKLLDFEQTTSYFL
VVHALSMAGVEASTTVIVQVGDVNDSPPVFQKIRYVGAISEAAPVNSVVVGEDGNPLVIQ
ATDRDRNHNALLVFQILDETARIFFTVDSGTGSIRTIASLDYETFSEFFFRVHVRDSGQP
PQSADNPAEVVIKVININDSPPKMLQDTYEAVLLLPTYEGVEVLTLEAFDPDMISDLPLN
PDKSVTSQLAYSLLDSNVDYFSVERYTGVVTVINQNLSKDRYRFNVKVWDGRFSSVAAVT
VLVREAVDNGLLFTFPVYSASIPENIPNVTLVTVVNTVGHRLNEPLKYTLLNPSGRFTIR
PTCGAVLTTGVPFDREDKESYELVVEVSREDEILKVARVTVRVQVEDVNDNAPEFVNLPY
YAAVQVEAEPGSAVFRVSAIDQDYGLNGEVTYSIKDEHRNFRMNQMSGELTLKRAFEADL
SNAEYKVVLVATDRGSPPLSSEVELPVTVVNKAMPVFDKPFYGVTVREDVAVSTSVLRIN
ATSPEGQSVIFTITDGDPSLQFDIGFDTGVISVIYLLDYETTQYYRLTVKATDTLSGARS
EVDVDVVVLDVNDNPPLFQNTSYSAVLAENSMIGTSVLPILVFAQDQDSEKNALVSYQIL
HDIYNSTNYFHIDGKSGLVYTARLLDYELTQRYNFIVRATDSGEPALSSDVSVTVTVSDT
NDNPPNFSRALYEAFVSELAPLGHFVTCVQASDADICDAHRLRYTILSGNEKMTFMMEPD
TGVLKLSNKRRQGMKILYQLNVSVSDGVFTNTAQVTVRVLGANLYSPVFSQRFYLAEVQE
NAPQGSKVIQVRATDEDSGLFGQITYSFINDLGKTKFTIDADGLISTAQKLDRENPLNRD
MVLTIMALDGGGRASFCTVRVVLADENDNAPRFRAVEYRMSIKANVAKGSLVTQIQATDN
DAGSNGRITYSLYSEARLSLVDVLEVEPDSGWMMTKSTMDHLQGTVLSFFVKATDCGSPA
KHSLVSAFIHVVPPDALVPSFSQPQYSFTIPEDTAVGTALGSVYMAPGQTGFFTVVRGET
LDSNQGGAFLVERESGLIRLIKPLDYELISIFRFKVAATTRRDLIESLSTVDLEVKVLDV
NDNKPTFETNTYVATVMEGMPVGTRVIQVRALDPDWGSNGQVTYGLGSLLTYNSDLTEDA
RALSGPVTTGSVFAIDSKTGWITTLGEMDHEACSSYSFKVVASDLGELQSLSSTTVVTIT
VSDVNDNPPRFESELYRGAVKESDALGEVVAVLKTNDGDGTDQNRLVNVYITGGNPRGVF
GLALVQAEWKVYVSGLLDREQQDWYLLNITASDGLYVARTAVEVTVIDDNDNSPVCNQAV
YSASFPEDIPTNRGILTVGATDADSGSSAEIQYSLFGIGVEDFYMDANTGELRTATVMDR
EKTPTYKLIAQATDGGGLFCRSDISLKVLDVNDNAPSFTSAHYLASVYEDAAPKALLTRL
QASDPDKGLNRTVVYSLVDSINGLFSIDPVSGMVILEKSLDRESQDSYRVSVQATDQVGQ
QGALSTQVDLTILVLDVNDNAPVFQRRDYAITVPEDVAVGTEVLRVLATSADIGPNAEIT
YNIRSGNELRKFTIDRNLGSISVVDDLDFEVCKDYYLTVEATDSGNPPLRTATMVTIELM
DVNDNAPAFSQNIYNVLVSEDASVGQTITRVLAEDLDSQVNGRITYSILKGDRSNHFWID
PVTGLLKVNKRLDRELVSRYSLSVQAFDSGSPAMSSTVTLNIDISDVNDNPPLFSPPNST
AVIKLNQAAGTSLLKLSISDKDSTRNGPPFEFRIVSGNEKNFFSMDQTGNLMTKRVFGPE
APREFTLEIQASDSGKPRLASSSWIFIRVIGDSQYKPTVSPLEIFIAMVTDTFQGGLIGQ
IYATDRDPNDVLSFTQKPQPKSMFEINRQDGSVMALPGLEPGRYQMNATVSDGRFAVIAD
VSVQVEQVTDMLLRSALTLRFNTLSPEDLLGRYLNQIKLTLRGIAGWNWSPGQQDPLHIL
SVQPVMGTSGVDLLLAMEVPETSGSSGRMLGIYSQQELSAKLKEAAARGQIRGVLGGAVV
VDSACSGELECGDRLCEQRLVREGDSLLTYRTERVSLVSPRFRPTETCTCPGGTCPAPVE
LCEGQSCPADMQCVRSGPTAPSVCQCQTNRRDECAGQTSLSFSGNSYIKYRVTESGRVGE
MKLGLRIRTLQKRGVIMFTRVNPCTMLKIEEGRLWFQLDCDNTLGIMGISGRPINDGLWH
AVVLELTRNYTLLSLDDSYVERRRAAQAPVRLWPLALDSSFFFGAQRGAQELGERGARAP
PRAQDGFQGCLGSLMLNGNELPLQNKRSRYAEIAGLSEVKLGCVLYPDPCVSQPCLNGAI
CSSLPSGGVMCSCSGGFSGGRCEIELTSCMPNPCLNGADCQPVGSAFLCGCSGGLRGLIC
EKDVNECDQDVCGSAGECVNTFGSFYCNCSEGNKGQFCDDQAPEDPGDDTQAEPLTYLGP
GEIIGIGVLAFVIILLLILFMAFRKKIKFRKDSDPGPGTQAGMGVSTISTETSYMLHKTG
TGSEGIEFKAVRVSGAQSATSTYGEVGVNTMGPPQVIVRPTTLSPLPGGLSSYSLRSGDG
DKNTFSEGSQPQDTMSSFLSDISSVRGAANRRGIAVCSVAPNLPSASARRPEHSPAHKRK
WEIGHSLEVSELVEEVACLSNSTSEDRSLNSFTSESFDDNAYHWEPSSQTSSWLSPSRLR
PPELGSHYDLSETLQSIRRGGSTRSLQLDYKVHGHDSCEQSSSPVYEEYRVSSRDPEPGE
DAESVYDTLPPTRQAYEGYPLSPSGVDLHPAQLLPP
Download sequence
Identical sequences G3QBG4
ENSGACP00000027230 69293.ENSGACP00000027230 ENSGACP00000027230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]