SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000027257 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000027257
Domain Number 1 Region: 13-282,310-340
Classification Level Classification E-value
Superfamily DNase I-like 1.28e-59
Family Inositol polyphosphate 5-phosphatase (IPP5) 0.0000355
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000027257   Gene: ENSGACG00000020608   Transcript: ENSGACT00000027309
Sequence length 448
Comment pep:known_by_projection group:BROADS1:groupVII:21356720:21363473:1 gene:ENSGACG00000020608 transcript:ENSGACT00000027309 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTGRLQSGGRDKCRLHIVTWNVATAEPPEDVTSLLQLDVQPPADLYVIGLQEVNATPVR
FISDLLAEDAWSHVFMDTLAPRGFVKVTSMRMQGLLLLVFAKQLHLPFIRNIQATYTRTG
FFGYWGNKGGVTVRFSFYGHMVCFLNCHLAAHMNYALQRVDEIEYILETQDLDLSDTPHV
RDHKAVFWFGDLNFRIADHGLHFLRSSINSGRLNLLWNKDQLTMMKKTEAFLQEFEEGPL
NFKPTYKFDRNSETYDTSPPRTWFGFTGKKRKPAWTDRILWRIKPKTFPSEDEDEKASTS
SDEGVDEYPLLVTQDKYTSDMSYGASDHKPVIATFSLELKKCFDTPLVHVSPLGVWSADQ
EALLNYTVQEDFLSSTWDWIGLYKVGFKSAFDYETFVWVREEDLPEINEVIQLHVDKDEI
PLLSGHYVLGYYSTNMKSIIGLSADFQV
Download sequence
Identical sequences G3QBJ1
ENSGACP00000027257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]