SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000027292 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000027292
Domain Number 1 Region: 8-119
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000025
Family V set domains (antibody variable domain-like) 0.029
Further Details:      
 
Domain Number 2 Region: 231-301
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000822
Family I set domains 0.012
Further Details:      
 
Domain Number 3 Region: 142-219
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000022
Family C1 set domains (antibody constant domain-like) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000027292   Gene: ENSGACG00000020634   Transcript: ENSGACT00000027344
Sequence length 308
Comment pep:known_by_projection group:BROADS1:groupVII:21614701:21623583:1 gene:ENSGACG00000020634 transcript:ENSGACT00000027344 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDGKWGFAGSKVDLRCRFINSFPPVKISQVTWQKLVNGTKQNVAIANPSLGVSVAPPYR
DRVTFKNAAVRRRTPTLEDTTITFSLLRLADESTYICEYTTFPAGNRENAVNLTVYVRPT
TQMSLSTPTLVARSSNLKTPVATCVSANGKPAGSIRWETRVPGEVTTREYRNSDGTFTVQ
SDYILVPSRETHKETLTCVTTYNEEVFTDSVTLDIQYEPDVSVDGFDGNWYLNRENVQLS
CQADANPPVSLYQWRLINGSIPSNAEIRDNVLTLKGPVTYDMQGTYVCDATNSIGTRSGS
LEISILGM
Download sequence
Identical sequences G3QBM6
ENSGACP00000027292 ENSGACP00000027292 69293.ENSGACP00000027292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]