SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000027295 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000027295
Domain Number 1 Region: 460-724
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.89e-43
Family Eukaryotic proteases 0.00000545
Further Details:      
 
Domain Number 2 Region: 174-437
Classification Level Classification E-value
Superfamily vWA-like 3.18e-30
Family Integrin A (or I) domain 0.00032
Further Details:      
 
Domain Number 3 Region: 68-129
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000667
Family Complement control module/SCR domain 0.00072
Further Details:      
 
Domain Number 4 Region: 136-192
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000334
Family Complement control module/SCR domain 0.00053
Further Details:      
 
Domain Number 5 Region: 16-76
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000612
Family Complement control module/SCR domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000027295   Gene: ENSGACG00000020636   Transcript: ENSGACT00000027347
Sequence length 745
Comment pep:known_by_projection group:BROADS1:groupVII:21643082:21651293:1 gene:ENSGACG00000020636 transcript:ENSGACT00000027347 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGEVRCDCTEEGIQIKGGHYTFTKQLKKGSTLIYQCPDGYYPYPHLSRLCQPNGSWKPP
PRRPTQKCRLVECPDPNVLQNGNILPSLERYYVHNETTCECYSGYTRKGSSNRVCLPNGK
WSGSTPICSRDSAENNCADPGIPAGASRTGNIFGIGNTVTYSCIDNLLLVGSEERVCQES
GQWTGIEPACYYRHTYDTSLEVSESFGSAIRDSLTVLKPSDETQLGRKIRIAKSGILNIY
IGVDISESIDQEDVDKAIDAITVLISKIASFSVTPNYEIAFFSSEVFEVVKILDFLNEGG
KPKNMIEELRKFKVDVKDKNTGTDLNLLFTTFEERMAVIKEQVGEKNFEEHRHVLIVFTD
GAFNMGGSPDRTVQKIKNMVYLDPTGQKKTDIYIFAIGTDILDTELMSLTAGNDGRHYFR
MKDITNLNETFDEIIDEEQVKDLCGLHKEYETVDKGIRKMYPWWAFITIVNGEKQRNCIG
SLVTSRFVLTAAHCFRFGDEAEHVKVEIDDGGRSEKTVKLFRLHPNYNITLKKKKGVDEF
YDYDVALIQLEKDVKISNIARPICIPCTSATSNALQLVGDSTCKQQEQILLKTNLERLNF
LNRQENTVALKQVYAKLGENRGECIRHALDAKGITTTDVREVVTDNFICTGGQTPFRDDV
ACRGDSGGAVFKDYERRTIQVALVSWGNEDLCASGGSAESRANSRDFHINLFKVIPFLKS
ILGKVDQTEYPPLHFLPNNVLVSHG
Download sequence
Identical sequences G3QBM9
ENSGACP00000027295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]