SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000027366 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000027366
Domain Number 1 Region: 613-889
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.7e-79
Family Protein kinases, catalytic subunit 0.000000000781
Further Details:      
 
Domain Number 2 Region: 24-197
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.95e-58
Family Ephrin receptor ligand binding domain 0.00000154
Further Details:      
 
Domain Number 3 Region: 324-533
Classification Level Classification E-value
Superfamily Fibronectin type III 4.63e-34
Family Fibronectin type III 0.00033
Further Details:      
 
Domain Number 4 Region: 907-977
Classification Level Classification E-value
Superfamily SAM/Pointed domain 8.25e-21
Family SAM (sterile alpha motif) domain 0.00069
Further Details:      
 
Domain Number 5 Region: 252-324,363-378
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000753
Family Growth factor receptor domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000027366   Gene: ENSGACG00000020695   Transcript: ENSGACT00000027418
Sequence length 984
Comment pep:known_by_projection group:BROADS1:groupVII:22515405:22528533:1 gene:ENSGACG00000020695 transcript:ENSGACT00000027418 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LELRCRNTAELLPIVCRLAAFSSEEVLMDTKTETSDLRWTIFSHATPAWEQVSGLDEESH
SVRIYQISQTDSSSSHWLRSGFIQRRGASQVYVELLFTMMECSSTSSNHRTCKETFNLYY
YQADSNNATSSYPPWMENPYIKVDTVAADFLLRQDRIRKFNVKTLRLGPLSKRGFYLAFQ
AQGASMALLSVRVFFKKCPPLVSALSSFPETVPHILVQEAQGVCVAHAAQQVPRPRPPKL
FCGEDGQWVGQPTTSCACLPGYESSEGHTVCTACPVGQFKPSSEGRCAPCPGFSHAAARG
APVCACRSGYLRAESDPPDAQCTTPPSAPRSVVTQINDTTLSLAWNEPLDSGGRADLSYA
IECSVCRSPRGPCSSCGDSVSYRPAQRGLQGRRVEVWGMLPQTTYTFTIQTLNGVSRLSG
KDPASETVNITTSHDVPSLVSVVRKGDSTESSLTLHWSVPAQPHYAILQYQLRYCEKQER
RSEDQCHYTESKRNQAVLTDLRRATQYEVQVRARTAAGYGSFSPAALFHTLPDGHDSAAQ
FLIPGILIAVGMLLLVAFVLVAAYCIRRHSRVKDPELSDKNSQYLIGQGVKVYIDPFTYE
DPNEAVREFAKEIDVSFVKIEEVIGAGEFGEVCRGRLKVPGKKENYVAIKTLKGGFTDKQ
RRDFLSEASIMGQFQHPNIIHLEGIITASCPVMILTEFMENGALDSFLRLNDSQFTPIQL
VGMLRGIASGMKYLAEMSYVHRDLAARNILINSNLVCKVSDFGLSRFLQENSSDPTYTSS
LGGKIPIRWTAPEAIAFRKFTSASDVWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDY
RLPPPPDCPTHLHQLMLDCWQKDRSARPRFSDLVSALDKLIRNPASLKIVAQDGAGPSYP
LLDQRAPVGLSSCASVGEWLRAIKMERYEDSFLQAGFNSVDQLTHITTQDLLHMGVTLAG
HQRKILSSIQTMTFQNKSTANVTF
Download sequence
Identical sequences G3QBV0
ENSGACP00000027366 ENSGACP00000027366 69293.ENSGACP00000027366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]