SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000027473 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000027473
Domain Number 1 Region: 963-1023
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000000294
Family ATI-like 0.018
Further Details:      
 
Domain Number 2 Region: 568-628
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000000311
Family BSTI 0.052
Further Details:      
 
Domain Number 3 Region: 1351-1410
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000147
Family ATI-like 0.014
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000027473
Domain Number - Region: 234-285
Classification Level Classification E-value
Superfamily FnI-like domain 0.000178
Family Fibronectin type I module 0.033
Further Details:      
 
Domain Number - Region: 2069-2108
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000321
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000027473   Gene: ENSGACG00000020778   Transcript: ENSGACT00000027525
Sequence length 2116
Comment pep:known_by_projection group:BROADS1:groupVII:24910348:24922434:1 gene:ENSGACG00000020778 transcript:ENSGACT00000027525 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KDILYPYGPDHRDLETPKMDDGSSAEITLLIQFYFFSVPYRTIYINNNGVISFNVQVSQF
TPEAFPLSDSRSFIAPLWADVHNGIRGDVYYRETIEPEILERATQDVRRYFKTFPTFTAT
WAFIATWHQVTFYGGSQTTPVNTFQTVLISDGVTSFNMFNYGEITWSTGTASGGDPLTGL
GGTTAQSGFNGGDIGRFFNLPGSRSNDVVNIEQTTNVNTPGRWLFRVDTELIDPANGCSF
NGRFYRRGEVFWLSDQCLQRCRCLDINNEVQCQESPCGQLETCEQQEGAFYCQPTRTSTC
VVFGDPHYHTFDGLLYHFQGTCSYLLARPCWEVAGLPFFSIEAKNENRGVASVSWLRDVT
VEVYGHRVMLPKGSFGTVQVDGLVKTLPVQLQLGAIRVYQSGVAIALETDFGLLVTYDGQ
HYASISLPSSYFNNTCGLCGNYNDDPADDPVLPDGSLAESVVELGGSWRAEDTDWRCTDG
CAQNCSVCDAVTEAFYFRPDYCGLINKTDGPFRDCRAVVDPTAFVYSCVYDMCSNRDNIT
TLCQAIQAYALACQALGVTIRPWRSRTFCALSCPKFSLYQVCTSACPASCSDLTAPLYCA
HPCTEGCQCDPGYVLSGSRCVQLEDCGCDHNGLYYPLNNTFWSGPSGEEGECALRCTCGP
AGEVSCFNESCKEGEVCVAEMGLPGCYPRREGVCSITQNSVTTSFDGTFLLIPDDSSYYL
LKLCSAVPANGSMVEVKMGRRLMNKGPTWKRPVVVTVANLEAQIGGTDFDIVKVNGEPVL
LPYVHPLETMMIYRAPGNATVVESRGLLRVQYTRQGFLNISLSTLFYNVTCGLCGVFNSN
ATDDLRLPNGRQAESTEQFADGWRSIADDLTCNGDCDALYQMCTDLRLYQNPWMCGNIND
PGNSSFLACHAVVNPSPFFRNCLYNMCVKEGNRSALCSSLQAYATACQDAQVGLASWRSV
TNCPLPCPQNSHFDECTGACPLTCANLDEPEDPCPLACQEGCQCEEGFALREGLCVARSD
CGCMGHGRQLATNQTFWTDWECQERCFCNGTDNSVYCQLAPCHPDEYCEENDGLYFCKPR
TEALCVAAGYGHFLPFGGVPFELQSSCSLRMATTNCGGENSDRTTTSETVPQFKLAARNE
ERDTGQAIWVRGFVLEVYEYEIEVSRSYKNTVTVNKERLYLPLKLGPGKVNIFSWGTQLI
LETDFGLKVAFDWNTLLLLTLPRDLYNAACGLCQGMPLSPPTLTTTDWGMAWAERDTFCQ
VGCGDSCPRCGLGETSAPEAVRLCGLIVDRGGAFARCHSKVAPAFFYQSCLQDTCLDQGA
QDTVCNWLQMYASTCQTQGVPVTGWRSDTPCVHSCPPNSHYSSCVPVCPPQCAPARGQRD
CSQDCVEGCQCDQGYVLNGKGCILPQNCGCYTDGKYYEPKQLFWNNDCTKRCQCIGRNLI
QCDPRRCKAEEECALRYGVRGCFARRSQHCVASGGGVFRTFDGASLRLPASCSFVLSTNC
RKLPDLSFQLIANFDKWSTPNLTTISHVYLYINEENILISGSTVKVNGTPVSVPFVTGLM
TRLSTSEGFIVIDTPQDIQVRYNHFNTLSITMGQRLQNKVCGLCGNFNGDPSDDYITSRG
KPAVSALELAQSWKTNGMQNRSGCRSASSSCDETQFVALAQSCDNTEVLALQSEDACQKL
TQLKGFFQPCHGLLDPRPFYQSCYLDGCYNHRKAQVCGSLAAYAEACRSMGTLTTKWITQ
ENCSEWIYDPCAGDICTNFTCELENGGDLCGCPELPASTAGDDDIIQAEVNCKHAQMEVS
ISKCKLFQLGFEREDVRVNDQHCAGIEGEDFISFRINNTKGHCGSIVQSNGTHIMYKNTV
WIESVNNTGNVITRDKTINVEFSCAYELDLKISLETVLKPMLSVINLTLPTQEGNFITKM
ALYKNSSYRNPYREGEVVLSTRDILFVGVFVEGADENQLILIVNMCWATPSRHSSDRLRY
VIIERGCPNIKDNTIGMAENGVSLTCRFHVTVFKFIGDYDEVHLHCDVTLCDSETNACKV
NCPHKRRMYSGDGDHREHILTVGPIRRREADWCEQENGGCEQICTSKATGPVCSCVTGML
QRDRKSCRSEHTDTHV
Download sequence
Identical sequences G3QC57
69293.ENSGACP00000027473 ENSGACP00000027473 ENSGACP00000027473

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]