SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000027608 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000027608
Domain Number 1 Region: 15-69
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000121
Family Ovomucoid domain III-like 0.013
Further Details:      
 
Domain Number 2 Region: 436-716
Classification Level Classification E-value
Superfamily 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.0000000000085
Family 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.049
Further Details:      
 
Domain Number 3 Region: 189-258
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000296
Family I set domains 0.059
Further Details:      
 
Domain Number 4 Region: 311-366
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000386
Family I set domains 0.033
Further Details:      
 
Domain Number 5 Region: 105-185
Classification Level Classification E-value
Superfamily EF-hand 0.000000956
Family Calbindin D9K 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000027608   Gene: ENSGACG00000020880   Transcript: ENSGACT00000027660
Sequence length 772
Comment pep:known_by_projection group:BROADS1:groupVII:27358709:27411614:-1 gene:ENSGACG00000020880 transcript:ENSGACT00000027660 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CRRTYCGRGRQCVLMPETGRAECVCQEKCRPSFVPVCGSDGRFYENHCEVYRTACLQRRR
IYVVHSKDCFFKGTASSTQWQQNRIQSILKASHPRNLNTVQECLFSTQSMTLCRNHFIHK
VTDQRDTMSKRECAQVSAKEHVEDGLLECTMQDLLRYDDYNNDGHLSLHEFYTAFQVVQL
SLAEDQSISVSTVTVGLSAVLTCAIQGTLRPPIIWKRNGIVLNFLDLEDINDFGDDGSLY
ITKVTTIHMGNYSCHAYGYEYLHQTHVLQVNXRENNMCFEKVSLRGPFCTAVLRTELDAA
ANSAPDINIECPSLHCLWMRSSLCPPAANGSELLIGSVRYEDTGAYTCIAKNEAGVDEDI
SSLFVEDSAKKTLANILWREEGIHYTPSKGLCAPFFSNGGRTASPPRDESVYEFLTKIFQ
LTKFNEEMCPKGEGVSPQRCVWSSAVNVRDKYVYASQPLQSRLLVVDIQAQKVVQAVTTD
PFPVKMLYDKSHDQVWVLTWGDMDRTHPTLQVIPQASVGEVHHAIRTTFQRVNDFFIPPT
NLIITHVRFAFVFLKDEPALHKIDLETFHRVKTISLRNHSCVPVSMAYTHLGGFFFVRCQ
SQLLIDSVTDAVVGPNLDVAGQPFVSPDGRYVVTPDPRRSKLVVQTVSFRGELGLSRELD
QPAAVSDLAFQPSFAESNQHAVVATSGSGADLLFADLSSGRTEVLRGLKEPLPPRAWPWG
GPNRVVVSSGPFGQYLVTPSAESLFVLDGKQRTHCEVSDIKRGNAVSGSASM
Download sequence
Identical sequences G3QCJ2
ENSGACP00000027608 ENSGACP00000027608 69293.ENSGACP00000027608

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]