SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000027654 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000027654
Domain Number 1 Region: 701-940
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.71e-85
Family Eukaryotic proteases 0.00000846
Further Details:      
 
Domain Number 2 Region: 279-437
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.28e-35
Family MAM domain 0.0046
Further Details:      
 
Domain Number 3 Region: 459-556
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.37e-26
Family Spermadhesin, CUB domain 0.00068
Further Details:      
 
Domain Number 4 Region: 155-268
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.06e-17
Family Spermadhesin, CUB domain 0.0033
Further Details:      
 
Domain Number 5 Region: 4-100
Classification Level Classification E-value
Superfamily SEA domain 0.00000000000017
Family SEA domain 0.0063
Further Details:      
 
Domain Number 6 Region: 563-601
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000113
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 7 Region: 115-154
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000034
Family LDL receptor-like module 0.003
Further Details:      
 
Domain Number 8 Region: 620-689
Classification Level Classification E-value
Superfamily SRCR-like 0.0000222
Family Scavenger receptor cysteine-rich (SRCR) domain 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000027654   Gene: ENSGACG00000020914   Transcript: ENSGACT00000027706
Sequence length 942
Comment pep:known_by_projection group:BROADS1:groupVII:27866930:27888087:1 gene:ENSGACG00000020914 transcript:ENSGACT00000027706 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ITEGAVFSEELKNSSSLRFKSLAYDVQQQVSKAFTHSDLAQVFKSCEVLYFSLGSVVVNF
DLSFHQLIDVKDTEQQLWAGLLESGTGELVIDRNSIWITGQLQVTGKIASTGNKTLLLCP
PDHTTCANQSMCVLINRLCDGVQDCPDASDEDATRCATVCDGQFILSDLNGSFCSSNVSV
MHNKSFCRWIVRLKPGLSVEIKFHYFETEENVNVLKLYENIGVEKQLAAELSGSNPPGTV
WLLTDQSTVEFISDDVNNLSGFKASYRAANLSNLSNQEKLTCTFERGMCFWRQQQEEDDG
DWIRTSIPTFPPLSGPSVDHTLNNSSGFYMVTPLSPGQWLKSFRMHSLRLSAQPQLMCLS
FWYHMFGEDVHRLRVLLSGPPVIVVIQRDGNYGDNWNYGQVTLNLTTETVVVFEALKKGG
MRNDIALDDITLTSDPCGPSPPEPTNVPPPTTAPPIPADCGGPFDLWEPNSTFSSPNYPQ
SYGNKAHCVWTLHTREGRNIQLHFLDFDVEATYDILSSMGGNSPLLRLVSTTNRMTVRFF
TDVSGNGRGFRANFTSGVNLGSPAACAVSQFQCRTGGCIHGNGECDGEVDCPDGSDEAEC
VVWQVNSSRRLQFQLISSLLTICADTWNPHLSVFTCQYLGYSSGESRLLPARPEDSPFAT
IRISSNGSLETSTSETCISGEVISLTCDNQRNQVKEIIAVSYDLTLRVVGGVDAVKGAWP
WIVSLQWRGRHVCGASVLGRDWLLTAAHCVYGKNLHLQSWSAVFGLHSQSDMNSLEVQTR
RVDRIWIHRHYNRETKQADIAMMHLQQPISFSQFIQPLCLPAEGQEFTAGTRCLIAGWGQ
TSEQGDLPDVLQETNVALLVQDQCQHQLPEYNITSSMLCAGHPEGGVDSCKGDSGGPLIY
EDNGHWILIGVTSFGIGCGRPQRPGVYTRVSAFSSWIAQTRR
Download sequence
Identical sequences G3QCN8
69293.ENSGACP00000027654 ENSGACP00000027654 ENSGACP00000027654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]