SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000000352 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000000352
Domain Number 1 Region: 1-456
Classification Level Classification E-value
Superfamily Sema domain 1.1e-111
Family Sema domain 0.0000752
Further Details:      
 
Domain Number 2 Region: 1298-1427,1622-1812
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.55e-49
Family p120GAP domain-like 0.023
Further Details:      
 
Domain Number 3 Region: 807-905
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000318
Family Other IPT/TIG domains 0.018
Further Details:      
 
Domain Number 4 Region: 903-991
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000356
Family Other IPT/TIG domains 0.036
Further Details:      
 
Domain Number 5 Region: 991-1095
Classification Level Classification E-value
Superfamily E set domains 0.00000000000104
Family E-set domains of sugar-utilizing enzymes 0.076
Further Details:      
 
Domain Number 6 Region: 459-511
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000589
Family Plexin repeat 0.0016
Further Details:      
 
Domain Number 7 Region: 759-795
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000366
Family Plexin repeat 0.0025
Further Details:      
 
Domain Number 8 Region: 1105-1182
Classification Level Classification E-value
Superfamily E set domains 0.0000577
Family E-set domains of sugar-utilizing enzymes 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000000352   Gene: ENSGACG00000000280   Transcript: ENSGACT00000000352
Sequence length 1842
Comment pep:known_by_projection scaffold:BROADS1:scaffold_114:235561:271705:1 gene:ENSGACG00000000280 transcript:ENSGACT00000000352 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTHLTVHRRTGEVFVGCRQQSPANLTELRSHMTGPVEDNAKCISPSVRACALRLDSSDNV
NKLLLVDYTGNRLVACGSIWQGVCQFLRLEDLFKLGEPHHRKEHYLSGAREADGMAGVVV
GPAKGGSRLFIGAAIDGKSEYFPTLSSRKLVADEESVNMFSLVYQDEFVSSQIKIPSDTL
SLYPAFDIYYVYGFSSRTYVYFLTLQLDTQLTQMDAGGEKFFTSKIVRMCSNDTEFYSYV
EFPLGCTKDGVEYRLVQAAFRQKPGRRLAQALGLSEEDDVLFVVFSQGQKNRSNPPRETV
LCLFTLQHINLAMRERIRSCYRGEGRLSLPWLLNKELPCIHTPKQIGDDFCGLVLNQPLG
GLRVIEGSPLYEDRTEGMGAVAAYTYGEHTVVFVGTRSGQLKKIRVDGITPPAQNALLYE
TVMVVEGKPILRDMVFSPDHQHIYLLSDRQVSRLPVESCERYSSCSACLGSGDPHCGWCV
LFNKCSRQEACNKWEEPQHFNTRLEQCVDITVTPSNMSVTSPLCKLTLWVRNVPALLGGV
SCVFEELNETPGEVQAKGQVMCMSPSLRDLPSHTHTHCERSEWSISGLRSTETGLQFIST
NFIFYNCSVLNSCTSCVSSVFPCHWCKYRHVCTNNLQDCSFQEGRVSSIEGCPQILPTAD
ILVPAGMVRPITLRARNLPQPQSGQKNYECVFHIQGKVQRIPAVRFNSSCIQCQNTSYWY
EGDEAGDLPVDFSIVWDGDFFIDKPPSMKAALLYKCEAQRSSCGQCLKAPTAFECGWCSD
SRRCLLRTHCPSAEQSWMHHGRHNLRCSHPRIARIDPLTGPREGGTRVTIEGENLGLQVK
EIAHVQVAGVRCNPVPAQYISAERIVCDMAEALLPHSPGGPVELCIGVCSSEYRTLSTQT
YSFVSPVFTRVLPERGPVSGGTRLAVTGRNLDAGSSVTVFIDKEECLFVKRTNREIICIT
PASLSGPGPAPIRLMIDRAEVTSSETKYVFTEDPTVSSIEPNWTILNGSTVITVTGTNLR
TIQEPKVRAKYRGVETSNFCSALNDSTMTCLAPGLIYGEPDPPEGALHPDEFGFIFDQVS
SLLVLNSTPFTHYPNPTFPLGSSGILEVKPGSPIILKGKNLVPVAPGNNRLNYTVLIGES
PCLLTVSENQLLCDSPDLTGEQRVLILVGGLEYSPGTLHIYSDSALTLPAIIGIGAGGGV
LLIAIIAVLIAYKRKTRDADRTLKRLQLQMDNLESRVALECKEAFAELQTDIQELTNDMD
GVKIPFLEYRTYTMRVMFPGIEEHPVLKELDSPANVEKALRLFSQLLNNKMFLLTFIHTL
EAQRSFSMRDRGNVASLLMAALQGRMEYATVVLKQLLADLIEKNLENRNHPKLLLRRTES
VAEKMLTNWFTFLLHRFLKECAGEPLFMLYCAIKQQMEKGPIDAITGEARYSLSEDKLIR
QQIDYKQQTLMCIPPEGEAVTEVPVKVLNCDTVTQVKDKLLDAVYKGIPFSQRPQADDMD
LEWRQGRLTRIILQDEDVTTKIESDWKRLNTLAHYQVTDGSLVALVQKQVSAYNIANSFT
FTRSLSRYESLLRTSSSPDSLRSRAPMITPDQETGTKLWHLVKNHEHSDQREGDRGSKMV
SEIYLTRLLATKGTLQKFVDDLFETVFSTAHRGSALPLAIKYMFDFLDEQADKRQISDPD
VRHTWKSNCLPLRFWVNVIKNPQFVFDIHKSSITDACLSVVAQTFMDSCSTSEHRLGKDS
PSNKLLYAKDIPNYKSWVESRYYRDITKMPSISDQDMDAYLVEQSRLHGTEFNTLSALSE
LYFYINKYKEEILTALDRDGYCRKHKLRHKLEQAINLMSGSS
Download sequence
Identical sequences G3N4Y2
ENSGACP00000000352 ENSGACP00000000352 69293.ENSGACP00000000352

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]