SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000000538 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000000538
Domain Number 1 Region: 325-522
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.6e-30
Family Laminin G-like module 0.0092
Further Details:      
 
Domain Number 2 Region: 574-617
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000935
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 3 Region: 54-145
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000585
Family Cadherin 0.01
Further Details:      
 
Domain Number 4 Region: 612-652
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000599
Family EGF-type module 0.0088
Further Details:      
 
Domain Number 5 Region: 537-574
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000739
Family EGF-type module 0.014
Further Details:      
 
Domain Number 6 Region: 2-56
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000842
Family Cadherin 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000000538   Gene: ENSGACG00000000415   Transcript: ENSGACT00000000538
Sequence length 1120
Comment pep:known_by_projection scaffold:BROADS1:scaffold_119:181940:203489:1 gene:ENSGACG00000000415 transcript:ENSGACT00000000538 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EFVLEKDGTLVANQVFRRDLATEYAIIIQVTDSGKPRMSSTSMLTVRVIEESLHRPVALP
LQVHIVTMEDEFPGGVIGQLHATDADPYDALTFGHAPLAQRSLFKISPRDGKIIALGGLD
AGRYALNASVSDGRFAVPVPVSVHVEQVTPEMLREAVTIRFESVAPQDFVALHLKSMLKV
LRKAASSQQRDKLHLLSLQPVGGTQQLDMLVAVETAGGGYYKTAYLTQKLSASRRQLEEV
LRVSAILDKNCSGLECRGAQCEQSILLDSHSLATYSTPRVSFVSPRFHRTSHCTCNGEGC
YHLFKQCEGQPCPADMQCVSIQATRGHYACQCPTGKLGECAGHSSLSFSGNSYIKYRLSE
WLQEELKVSLRIRTLQRRGIIMYTHTEPCLVLKLEDGKLWFQLACGLGSDGGDNPDMLGI
SGHHINDGSWHTVALELNRNFSSVALDDSYVERRSAAPFTQPLSPDRSIYFGALVQPPNS
RSLVDSQKDPQVLEGFQGCLDSVTLNNNELPLQNKRSRYAEVVGLTDLKLGCILYPDACL
QQPCRNAAICTSLPSGGFSCTCKPQYTGGRCEMEITACIPNPCQNGGACRPIGNAFLCSC
RRGFKGLICEEDVNECDQGNPDGECDNSGVCVNTYGSFYCNCTAGFVGQRCGLRPVVVPD
MQAGHTVVGKEELIGIAVVLLVIITLILLFIAFRKKVFQKNYSRNNLSLVQDPATAALLN
KANGVQFKTLHCTPGDPLHLYSETGHGAIVAGGGGMMGPPQVPVRPMAYTPCFQGDPRST
LEKLVDGRGVEHTEMSTFHPESPRILSGTTRRGIVVCSVAPNLPPVSPCRSDCDSLRKSP
WDDEGEMVDMAEEVTCFSGSNKSSNSEVQSLSSFQSDACDDNASIVTVIRLVNDAVDTIE
SEVSVMDYSYGQTYNRAYHWDTSDWMPSTRLSDIEEVPGYEAGPGINVAGTAPRLEGSTR
ELESDYYLGGYDIDSDYPHPHEEEFLSQDQLSPPLPTGEDYAELYVPLPTNTPISKDSTL
SSGSTGHQHALPRFHPSQYLPPHQMPVGEAPRGDFSSSINGISPGNGGTDVGLSVGASSA
SGMFAHCSLDDSEHGSNFDSMDEICRGVTIITDSQQQTEV
Download sequence
Identical sequences G3N5G5
ENSGACP00000000538

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]