SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000001020 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000001020
Domain Number 1 Region: 1020-1123
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.53e-28
Family Calponin-homology domain, CH-domain 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000001020   Gene: ENSGACG00000000791   Transcript: ENSGACT00000001020
Sequence length 1462
Comment pep:known_by_projection scaffold:BROADS1:scaffold_47:599047:630390:-1 gene:ENSGACG00000000791 transcript:ENSGACT00000001020 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KASKFQFAASFHELMIECTDKWQPDKLRVSWIRRTRRHSTKLHSWQPGIKNPYRGLVLWQ
VPESLDISVTLFKEPTADEFEDKDWTFVIENETKGRRKVLASADVNMKKFASATPAQYDV
TLKLKPLSVKVVEATLKLNLSCVFLKEGKATDDDMQSLASLLSMKQSDIGNLDDFIDSDD
EGGEERRASFGQATHVTVLKGLCEKPQAGSGFIPSWRPQTPPIAETLSPSPLSPSSAHVL
FGQPYKSQTATTANSDAAPDATAPASRRPEPPRASDRGRDPHAGMHVVKASAGPRKPVVQ
GLKYFEMPKPQDEASPIGFNLDTETSIPSITQPGIAYHGSGVPSLMEPLRKGCPADYKPL
EVIQTEKYIVVIEKRPHYNDMNNDTRAMSALAPTCPKSSCIVGFSSMQRDDSKDCNTFHE
PLLTSCPREARVHGFPSAPVTNRPPNMQGHLAKHEEDEAKYMVAMAASCTHSTEIPGLPS
ISQLNSAEKEKAKIIGNGPADGGASTTHTLPVGRLQSAPGILSQSQVERTVAEVAQTKGK
KPMETPDTAGVLGWEVMEAEGTITENQAPSSFPAKVEDTSGLVKAIVGVFNKGPSSSTLD
ETHFAGSTTSIQKIESQLEDIYIKDKIEYPGSARQQTGTEEEEVRTDSISSQRNEGLPLE
TPEKTAPCKPLRRKDSVTRETLVPKTNDQQDLKAKSIDEPSQTEMSLLPSQPVGKKEQTI
KKHREEIQQSHIAGEKTVDMIGIMSSQKKEETSEKGQAEKDRQTSLCIPRPPFSSTTNKL
SKAKHSKQFPSLPLGDQPSSSTKIMNPVTLRRSRSATEGRVQGEDGHISEKTPGASGLPV
PKPRVKKRLNNTVLATNVSPPELELRNPEAIHATGKETKEGPKSLDSSVISEGGFVTIQG
EDNGASQLEREVLEAMEEKKPVATNDSEKAAECMPQQANIEKVLGEEVDRAQTSQDDWLH
VGDKDSERVETNARKEMRQREKSQVGCFHQANETTTQQKRPADGDTAPEGFSPTPSLVTS
SQSLLDWCQEVTQGHKGLKITNFSTSWRNGLAFCAILHHFQPENINFEMLNPYDIKDNNK
KAFDGFAELGISKLMEPSDMVMLPVPDRLIVMTYLNQIRTHFTGQQLSVLHIAKNSSESS
YAVAGDREGQEDPEATVRYCAQRLQEEGISLDTNGTAGTAQSADNKTRDVVPPPRSRREQ
VAGVQPPVAPPRTHFLSKTGFSHVKDADLVKKRRSQRRSMSLEEGDISVVGICICRTERT
EAEVEEGRSESQVSPHFFHCRVEYLQVPNCLFLYECIQDPNQYVLSQIEALEAEQSHIDN
RAGVVERKLRQLLETGSDKVEEERLIQEWFILVNKKNALIRRQDHLQLLLEEQDLERKFE
LLNKELRDIMAIEEGQKTPVHKQREQLLLQELVSLVNQRDELVHNIDAKERGALEEDERL
ERGLEQRRRKYAKQQKEKCVMQ
Download sequence
Identical sequences G3N6U5
69293.ENSGACP00000001020 ENSGACP00000001020 ENSGACP00000001020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]