SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000001372 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000001372
Domain Number 1 Region: 647-898
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-53
Family Protein kinases, catalytic subunit 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000001372   Gene: ENSGACG00000001063   Transcript: ENSGACT00000001373
Sequence length 930
Comment pep:known_by_projection scaffold:BROADS1:scaffold_27:3053896:3067281:1 gene:ENSGACG00000001063 transcript:ENSGACT00000001373 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGNVQQQKTTPLARELTRTFNSYNKHTVQLKKNLKETNAFFREIRQNYSNACASTMSSD
SASFEAGQLSCISFPGHEEEFLRNTVGAAPCILVLGQDCAARYQLLNCLLGERLLPLCLE
AGEACKGVQGSVCKRRKLCFTHGRQTRLSLALPGQYELVHQLAANCGRWDTVPREDLEIH
EECEDPAHRLAELEITLHHPLLQEAKVMVVPCQSVQPIEEALADCTRTVIPILLYAINQD
TLGTDHVAELRKVKEMLSFPICFIRIPDPMPAASPEPGRRGEREKERDREKSALFKQLLS
LGFLSNPVGNCSCGAPTQTSAPGAKPLSLLVEAFERLHRLLVPFTRQVLQNQQVEAANLL
NGVHCRCLDIFINQAFDMQRDLQITPRRLEYTREKEGELFTSLMAIANRKQEEMKEMIVE
TLGSMKEQLLEDAANLEFTADIIVTTNGDPVTSKEIKSCIHQIQELIVVRLNQAVANKLI
SSVDYLRESFVGTLERCLNSLEKSHMDSSVHNITSNHLKQLLNAAYHVEVTFHSGSSVSR
LFWEQIKQIIHRITFVNPPAVSPEWKRKVAQDAIESLSAAKLARSICSQFRTRLNSSHEA
FAASLRQLEEGHTGRLERTEDLWLRVRKDHAPRLARLSLESRSLRDVLLHGKPKLGRELG
RGQYGVVYLCDSWGGHFPCALKSVVPPDDKHWNDLALEFHYTRSLPKHERLVDLHGSVID
HTYGGGSSIAVLLIMERLHRDLYTGLKAGLSLRERLQIALDVVEGIRFLHGQGLLHRDIK
LKNVLLDKQNRAKITDLGFCKPEAMMSGSIVGTPIHMAPELFTGKYDNSVDVYAFGILFW
YLCTGSVKLPEAFEKCSSKDQLWNNVKKGARPERLPTFDEECWQLMEACWNGDPSLRPLL
GIVEPSLQSIMVRLCNRGSEQKSSSLDDSN
Download sequence
Identical sequences G3N7T8
ENSGACP00000001372 ENSGACP00000001372 69293.ENSGACP00000001372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]