SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000001703 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000001703
Domain Number 1 Region: 471-720
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.2e-59
Family Eukaryotic proteases 0.0000776
Further Details:      
 
Domain Number 2 Region: 382-467
Classification Level Classification E-value
Superfamily Kringle-like 2.3e-33
Family Kringle modules 0.00011
Further Details:      
 
Domain Number 3 Region: 202-285
Classification Level Classification E-value
Superfamily Kringle-like 1.84e-31
Family Kringle modules 0.00017
Further Details:      
 
Domain Number 4 Region: 109-202
Classification Level Classification E-value
Superfamily Kringle-like 1.16e-30
Family Kringle modules 0.00018
Further Details:      
 
Domain Number 5 Region: 293-378
Classification Level Classification E-value
Superfamily Kringle-like 2.3e-29
Family Kringle modules 0.00018
Further Details:      
 
Domain Number 6 Region: 29-119
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00000000000000165
Family Hairpin loop containing domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000001703   Gene: ENSGACG00000001303   Transcript: ENSGACT00000001704
Sequence length 722
Comment pep:known_by_projection scaffold:BROADS1:scaffold_27:3770787:3781105:1 gene:ENSGACG00000001303 transcript:ENSGACT00000001704 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NTSVVQVPQICIFVLCLIFFLFHCAQTGYRSPLNDFQRSEGRELVPTSWNSARVLLLPGL
NLEDCATRCAQSLDCSTRAFNYETRPTVSCKHLPWVGDGSNAEVKRNVNCDLYEKKVYVR
KCIVGKGEDYRGKVFTTRGGLTCQQWWSKFPHDHRWTPTATNGLELNYCRNPDGDRIGPW
CYTTDPERRYESCNIPQCKDEVCIRCNGEDYRGQVDHTVSGRECQRWDQQYPHQHIYQPE
KYPDKSLDDNYCRNPDASPVPWCYTTDTEVERENCEISKCTEVQVEKRQRSSFTTNCFRG
RGEDYRGKVNETTSGIPCQRWHAQHPHEHPFYPNTYECKGLEENYCRNPDGSEAPWCFTS
VPTMRTALCLQIKRCADDIEAEDCYHENGRNYKGMVRKTRKGITCQKWNANTPHLTKINL
STHPEANLTENYCRNPDGDQHGPWCYTTDPKTEFDYCAIKQCAGEKVSMIEPAAKVEFSE
CGKREDRLQPTRMRIVGGIPGNSPWTVSLRDRKGNHFCGGSLVNPRWVISTKQCFSSCYV
DLPGYSAKMGTLYRDPQEGEPGVQTIPLTKIVCGPSESQLVMLQLEYPAQFNERISQICL
PPERYIVSEGTSCEIAGWGETRGTGDETVLNVAYIPVLSNKECNKYFRGRVRENEMCTRS
FQGGVGACERDYGGPLACQNRDCWVLEGVIIPMRRCGHPGQPNIFIRVSVYVDWIKKVME
MA
Download sequence
Identical sequences G3N8R7
ENSGACP00000001703 69293.ENSGACP00000001703 ENSGACP00000001703

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]