SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000002580 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000002580
Domain Number 1 Region: 147-396
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.25e-49
Family Protein kinases, catalytic subunit 0.0000316
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000002580   Gene: ENSGACG00000001989   Transcript: ENSGACT00000002589
Sequence length 434
Comment pep:known_by_projection scaffold:BROADS1:scaffold_149:44544:53134:1 gene:ENSGACG00000001989 transcript:ENSGACT00000002589 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSNTSADNLCAPNNQLCIVTYHMKEVIIVPTLLILGSLVTLLALCLVMCCPERTQSRAP
QRPHSSSHRHNQRKSQRPHLQGIDAPPGINPLEHEELPMSVQQVQRQTVVPTRAAVPQVS
TERQHGAFSQVTALPRSFSIKPDDTVSLYRARMDNRDVVLRRLKERASSSEKQHFFGFAS
FVSGLGPHPFIPELLGVVSVQPPPMMVVEELLHRDLLGYLWRCRQNNSGSESSCEMTEKR
IFTMAGQVASALEYLHSQRCIHGNLGARSVLVGGDLTAKLWGLGSAYRRTTSAGPAEEIG
DKEMRKWQAPEVLSRRDFRQSSDVWSFGMLLYEMVTLGDPPFAQISVNELLQNLQRGKHL
KRPVRCSNSLYSIIRACCHWGPEQRVSMPELIKKLHQAERSANGSTVIRAAAPLDIEKYL
REAGFGEAYNYAVL
Download sequence
Identical sequences G3NB84
ENSGACP00000002580 ENSGACP00000002580 69293.ENSGACP00000002580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]