SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000003084 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000003084
Domain Number 1 Region: 154-272
Classification Level Classification E-value
Superfamily EF-hand 2.07e-35
Family Osteonectin 0.015
Further Details:      
 
Domain Number 2 Region: 242-334
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 1.05e-25
Family Thyroglobulin type-1 domain 0.00088
Further Details:      
 
Domain Number 3 Region: 91-134
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000652
Family Ovomucoid domain III-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000003084   Gene: ENSGACG00000002370   Transcript: ENSGACT00000003095
Sequence length 348
Comment pep:known_by_projection group:BROADS1:groupV:793362:803990:-1 gene:ENSGACG00000002370 transcript:ENSGACT00000003095 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SYVCNYSGRLFSIHHLKLYWKDDYIKNMEQNIGSDETVDTTKDPCQNVKCSRHKVCVAQG
YQRAMCVNRKKMEQRVKQSGQPEARESGCKPCPVVSSSSPVCGSDGHNYASQCKLEQQAC
LASKELSAACAGFCPCATASVSLSNTDTKPPSESCTGQDLADLGDRLRDWFQLLHVNAKQ
NNSGKLRGDTASALDKSLAASCKDSIGWMFSRLDTNSDLYLDQAELTAINLDKYEVCIRP
FFNSCDSYKDGKVSTAEWCLCFWREKPPCLAELERIQVQEAAKKKPGVYIPSCDEDGYFR
KVQCDQSRGECWCVDQHGGEMMGTRIHGNPDCDEAAGYSGDLGSGVGW
Download sequence
Identical sequences G3NCN4
ENSGACP00000003084 69293.ENSGACP00000003084 ENSGACP00000003084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]