SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000003417 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000003417
Domain Number 1 Region: 2-149
Classification Level Classification E-value
Superfamily EF-hand 5.81e-57
Family Calmodulin-like 0.00000082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000003417   Gene: ENSGACG00000002605   Transcript: ENSGACT00000003428
Sequence length 151
Comment pep:novel group:BROADS1:groupVI:993318:996867:-1 gene:ENSGACG00000002605 transcript:ENSGACT00000003428 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADQLTEEQIAETEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDA
DGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLT
DEEVDEMIREADIDGDGQVNYEEFVQMMTAK
Download sequence
Identical sequences G3NDL7
69293.ENSGACP00000003417 ENSGMOP00000007316 ENSGACP00000003417 ENSGACP00000003417 ENSGMOP00000007316

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]