SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000003516 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000003516
Domain Number 1 Region: 565-778
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.74e-93
Family Thrombospondin C-terminal domain 0.000000022
Further Details:      
 
Domain Number 2 Region: 442-562
Classification Level Classification E-value
Superfamily TSP type-3 repeat 1.57e-34
Family TSP type-3 repeat 0.00000084
Further Details:      
 
Domain Number 3 Region: 104-161
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 5.75e-16
Family TSP-1 type 1 repeat 0.00018
Further Details:      
 
Domain Number 4 Region: 373-444
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.00000000000000392
Family TSP type-3 repeat 0.00029
Further Details:      
 
Domain Number 5 Region: 300-385
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.000000000000012
Family TSP type-3 repeat 0.00012
Further Details:      
 
Domain Number 6 Region: 51-100
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000183
Family TSP-1 type 1 repeat 0.00032
Further Details:      
 
Domain Number 7 Region: 1-40
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000458
Family TSP-1 type 1 repeat 0.0019
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000003516
Domain Number - Region: 204-237
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0234
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000003516   Gene: ENSGACG00000002687   Transcript: ENSGACT00000003528
Sequence length 780
Comment pep:novel group:BROADS1:groupV:1690837:1697219:-1 gene:ENSGACG00000002687 transcript:ENSGACT00000003528 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WSEWTHCSVTCGRGGQQRGRSCNGIKPACAGPSVQTRSCMPLKCDRKAQSDGNWGLWSWS
ACTTTCGDGRIARLRLCSNPPPQKGGRGCVGGARETQICNNTLCPVAGGWTGWTEWSLCS
ESCGGGLKSRQRECLSPAPQHGGKPCAGDAVDYEACNKQPCPIDTCLISNPCFPGVECTS
LSDGSWECGSCPLGLHGNGTHCEDENECEVESVCVTQCVNTDPGFHCLPCPPRYKGTEPY
GLGLKEARKTRQVCEPYNPCKDNTHTCHRYAQCVYLGLASEVLFRCVCAVGFAGDGFLCG
EDSDLDGWPNARLTCKQNATYHCQKDNCPTLPNSGQEDLDKDGQGDACDPDDDNDDVIDE
RDNCPLVYNPRQFDSDRDGVGDVCDNCPFDSNPLQADTDDNGEGDACSIDIDGDEVLNDR
DNCPSVYNTDQRDTDLDGVGDQCDNCPLLHNPLQLDSDSDLVGDMCDDNEDIDEDGHQNS
LDSCPYIANSNQADHDKDGKGDVCDHDDDNDGIPDDRDNCRLVPNRDQLDSDGDGIGDAC
FDDFDNDSIPDALDPCPLNQDIGSTDFRKFQVVLLDPKGTTQSDPLWVIRSQGTELVQTA
NSDPGIALGYDKFNALDFSVTFYVNTNRDDDYAGIVFAYQSSRRFYVVMWKQVSQAYWEK
KPFKAFATAGVSIKLVNSTTGPGEYLRNALWHTGNTKHQVRTLWHDPNEIGWKDYTAYRM
HLIHRPKTGFIRVVVYEGRGILSDSGAVYDHTLAGGRLGLFVFSQEHVLFSDLRYECRGK
Download sequence
Identical sequences G3NDW5
ENSGACP00000003516 69293.ENSGACP00000003516 ENSGACP00000003516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]